DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grip and Stxbp4

DIOPT Version :9

Sequence 1:NP_572285.2 Gene:Grip / 50391 FlyBaseID:FBgn0029830 Length:1058 Species:Drosophila melanogaster
Sequence 2:XP_006247190.1 Gene:Stxbp4 / 303443 RGDID:1307903 Length:557 Species:Rattus norvegicus


Alignment Length:369 Identity:93/369 - (25%)
Similarity:137/369 - (37%) Gaps:109/369 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 ITVERESGCLGLTLRGGADY---PLIVTH-VRPHGPVYKTGRIKPGDRLLRVDNVSLIGKTLAEA 244
            |||.:|:| |||.:.||.|.   ||:..| |.|.|..||.||:||||:|:.::..|:||.:..||
  Rat    23 ITVAKETG-LGLKILGGIDRNEGPLVYIHEVTPGGDCYKDGRLKPGDQLVSINKESMIGVSFEEA 86

  Fly   245 QQIIKCGGHVSGYTNLTIEYDVSVVQSVEFSMGPLLIEIERPMNDKLGLVLCNYTAAVPASGSGS 309
            :.|:         |...:.::           .||.|...|..:      .|.:    |.:....
  Rat    87 KNIL---------TRAK
LRWE-----------SPLEIAFIRQKS------YCGH----PGNICCQ 121

  Fly   310 STPSSGEKIEESAGVFIASILPASIADRCGALSVGDQVLSIDDTMIEHTAFSPDEVMTILDTSTG 374
            |.|.| |..|.....|.....||.                   |::..|:.:|....:||.:.  
  Rat   122 SPPVS-EDCEPQTSAFNLLSSPAG-------------------TLLPKTSSTPRTQDSILPSC-- 164

  Fly   375 RGYTQMQIMPAHALARRGHTTLGSPKYSFSTLESRKSSTAGRQRQRFARKSSLPLENPACGTPGS 439
               |.:|..|.|:.|  |...:.|       |.:|.:.|:.                 |...|..
  Rat   165 ---TVIQTQPEHSQA--GLAPVPS-------LNNRPTDTSN-----------------ADIAPAW 200

  Fly   440 TGGSMGTGGIHGSSSLGMGLGLCRAESFPVLLDC--------SHGAGIILSETVSGSGGSGAVAI 496
            |..:.|.   .|..||.....| :||...:.|:.        .|.|   |.:.|. :...|.|:.
  Rat   201 TDDASGP---QGKISLNPSARL-KAEKLEMALNYLGIQPTKEQHEA---LRQQVQ-ADSEGTVSF 257

  Fly   497 AQIVPDSVADRSGCIQAGDRIVAINKMYS-LDAAAMRQLLEGGS 539
            ...|  .||....|:|..:..|..:::.| ||:    |||..||
  Rat   258 GDFV--QVARNLFCLQLDEVNVGDHELPSVLDS----QLLPCGS 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GripNP_572285.2 PDZ 82..147 CDD:294084
PDZ_signaling 183..254 CDD:238492 32/73 (44%)
PDZ_signaling 278..375 CDD:238492 19/96 (20%)
PDZ 496..>521 CDD:294084 6/24 (25%)
PDZ_signaling 571..658 CDD:238492
PDZ_signaling 832..913 CDD:238492
PDZ_signaling 973..1055 CDD:238492
Stxbp4XP_006247190.1 PDZ_signaling 21..94 CDD:238492 33/80 (41%)
TPR_MLP1_2 299..400 CDD:285204
GBP_C <306..389 CDD:303769
coiled coil 359..369 CDD:293879
coiled coil 378..389 CDD:293879
WW 502..531 CDD:278809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.