DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grip and Ptpn4

DIOPT Version :9

Sequence 1:NP_572285.2 Gene:Grip / 50391 FlyBaseID:FBgn0029830 Length:1058 Species:Drosophila melanogaster
Sequence 2:XP_017454155.1 Gene:Ptpn4 / 246116 RGDID:620712 Length:933 Species:Rattus norvegicus


Alignment Length:265 Identity:56/265 - (21%)
Similarity:96/265 - (36%) Gaps:79/265 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   728 SMDDASLQSVQLRSGSGS-NGGNQAANSWSTGVN----------------SRSYV---APPNTQS 772
            |.|....||:..||..|: |..|.:.....|.|.                |..:|   :|.:||:
  Rat   386 SDDRLETQSLPSRSPPGTPNHRNSSFTQEGTRVRPSSVGHLVDHVVHTSPSEDFVSQRSPSSTQA 450

  Fly   773 LTTEL---PEEEDEQEQMYPGYELNRYASVDCTALPPPME-----NKVYGS-------------- 815
            .:..|   |.:|..::...|             ||||...     |:::.|              
  Rat   451 NSIVLESSPSQETPEDGQPP-------------ALPPKQSKKNSWNQIHFSHSQQDLVNHTNESF 502

  Fly   816 -AASSSSKS--SGSSLHQIIFTVRLEP-KGGLLGITLAGSEDITKSITISGLVEGGIAHK-NGQI 875
             ..||..||  :|...|..:..::::| :.|..|..:.|..|....:.:|.:..|..|.. ..::
  Rat   503 DVPSSPEKSTPNGGIPHDNLVLIKMKPDENGRFGFNVKGGYDQKMPVIVSRVAPGTPADLCVPRL 567

  Fly   876 HVGDQLLAID-----EHSVQGMPLSHATSLLQNLGDLVDLKILRSHDLANGSHLPQTQAIYAKVQ 935
            :.|||::.|:     ||:...:.|....|..::.|:||              .|.:..|:|..|:
  Rat   568 NEGDQVVLINGRDIAEHTHDQVVLFIKASCERHSGELV--------------LLVRPNAVYDVVE 618

  Fly   936 RRPRS 940
            .:..|
  Rat   619 EKLES 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GripNP_572285.2 PDZ 82..147 CDD:294084
PDZ_signaling 183..254 CDD:238492
PDZ_signaling 278..375 CDD:238492
PDZ 496..>521 CDD:294084
PDZ_signaling 571..658 CDD:238492
PDZ_signaling 832..913 CDD:238492 19/87 (22%)
PDZ_signaling 973..1055 CDD:238492
Ptpn4XP_017454155.1 B41 30..229 CDD:214604
FERM_C_PTPN4_PTPN3_like 223..317 CDD:270010
FA 330..372 CDD:400882
PDZ_signaling 522..609 CDD:238492 20/100 (20%)
PTP_DSP_cys 648..921 CDD:421693
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.