DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grip and Cytip

DIOPT Version :9

Sequence 1:NP_572285.2 Gene:Grip / 50391 FlyBaseID:FBgn0029830 Length:1058 Species:Drosophila melanogaster
Sequence 2:NP_631939.1 Gene:Cytip / 227929 MGIID:2183535 Length:359 Species:Mus musculus


Alignment Length:215 Identity:49/215 - (22%)
Similarity:80/215 - (37%) Gaps:49/215 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   733 SLQSVQLRSGSGSN---GGNQAANSWSTGVNSRSYVAPPNTQSLTTELPEEEDEQEQMYPGYELN 794
            |||....|.||..|   ..:.|..|:|.               ||.:|..|::.:.|:.      
Mouse     2 SLQRFLQRQGSNGNLEYCADSAYGSYSV---------------LTGQLTMEDNRRIQVL------ 45

  Fly   795 RYASVDCTALPPPMENKVYGSAASSSSKSSGSSLHQIIFTVRLEPKG---------GLLGITLAG 850
                .|..|..|....::  :.|.|||....|...:.:.||..:..|         .|....:..
Mouse    46 ----ADTVATLPRGRKQL--ALARSSSLGDFSWSQRKVVTVEKQDNGTFGFEIQTYRLQNQNICS 104

  Fly   851 SEDITKSITISGLVEGGIAHKNGQIHVGDQLLAIDEHSVQGMPLSHATSLLQNLGDLVDLKILRS 915
            ||..|   .|..:.|...||..| :.|||....::..|.:|........|:::.|:|:.::.|  
Mouse   105 SEVCT---MICKVQEDSPAHCAG-LQVGDIFANVNGVSTEGFTHKQVVDLIRSSGNLLTIETL-- 163

  Fly   916 HDLANGSHLPQTQAIYAKVQ 935
                ||:.:.:...:.||:|
Mouse   164 ----NGTMIHRRAELEAKLQ 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GripNP_572285.2 PDZ 82..147 CDD:294084
PDZ_signaling 183..254 CDD:238492
PDZ_signaling 278..375 CDD:238492
PDZ 496..>521 CDD:294084
PDZ_signaling 571..658 CDD:238492
PDZ_signaling 832..913 CDD:238492 20/89 (22%)
PDZ_signaling 973..1055 CDD:238492
CytipNP_631939.1 PDZ_signaling 76..161 CDD:238492 20/88 (23%)
Interaction with CYTH1. /evidence=ECO:0000250 166..188 3/14 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.