powered by:
Protein Alignment Grip and F16G10.5
DIOPT Version :9
Sequence 1: | NP_572285.2 |
Gene: | Grip / 50391 |
FlyBaseID: | FBgn0029830 |
Length: | 1058 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_494256.3 |
Gene: | F16G10.5 / 184580 |
WormBaseID: | WBGene00017520 |
Length: | 92 |
Species: | Caenorhabditis elegans |
Alignment Length: | 60 |
Identity: | 23/60 - (38%) |
Similarity: | 30/60 - (50%) |
Gaps: | 5/60 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 569 SGVFSVKLLRAGKCGLGLSVSGSSHGGLVISDVKMGS-PAHRSGSLRSGDILLAVDQHPV 627
|.:.||.|.:|.....||.|.....|. |||.|..|| .|| ..|:||:::||:...|
Worm 5 SHILSVGLKKASNGEFGLQVMDGIRGP-VISFVSPGSASAH---IFRAGDVIMAVNDRQV 60
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3528 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.