Sequence 1: | NP_572285.2 | Gene: | Grip / 50391 | FlyBaseID: | FBgn0029830 | Length: | 1058 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_491965.1 | Gene: | smz-2 / 172415 | WormBaseID: | WBGene00020661 | Length: | 274 | Species: | Caenorhabditis elegans |
Alignment Length: | 195 | Identity: | 33/195 - (16%) |
---|---|---|---|
Similarity: | 74/195 - (37%) | Gaps: | 59/195 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 178 TSKLAQITVERESG-CLGLTLRGGADYPLIVTHVRPHGPVYKTGRIKPGDRLLRVDNVSLIGKTL 241
Fly 242 AEAQQIIKCGGHVSGYTNLTIEYDVSVVQSVE--------------------FSMGPLLIEIERP 286
Fly 287 MNDKLGLVLCNYTAAVPASGSGSSTPSSGEKIEESAGVFIASILPASIADRCGALSVGDQVLSID 351
Fly 352 351 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Grip | NP_572285.2 | PDZ | 82..147 | CDD:294084 | |
PDZ_signaling | 183..254 | CDD:238492 | 14/71 (20%) | ||
PDZ_signaling | 278..375 | CDD:238492 | 15/74 (20%) | ||
PDZ | 496..>521 | CDD:294084 | |||
PDZ_signaling | 571..658 | CDD:238492 | |||
PDZ_signaling | 832..913 | CDD:238492 | |||
PDZ_signaling | 973..1055 | CDD:238492 | |||
smz-2 | NP_491965.1 | PDZ_signaling | 7..77 | CDD:238492 | 14/80 (18%) |
PDZ_signaling | 114..188 | CDD:238492 | 15/73 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |