DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grip and Dlg1

DIOPT Version :10

Sequence 1:NP_572285.2 Gene:Grip / 50391 FlyBaseID:FBgn0029830 Length:1058 Species:Drosophila melanogaster
Sequence 2:XP_006521824.1 Gene:Dlg1 / 13383 MGIID:107231 Length:939 Species:Mus musculus


Alignment Length:46 Identity:11/46 - (23%)
Similarity:17/46 - (36%) Gaps:15/46 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 DVALNTNFDASLSNCGKDVSQVQWCQSHCQDKTLENVIVSSAVING 130
            |::.||......:|.|               |||....::.|.:||
Mouse   231 DLSTNTQEKKHYANVG---------------KTLGERAITRAPMNG 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GripNP_572285.2 PDZ_canonical <96..163 CDD:483948 8/35 (23%)
PDZ2_GRIP1-2-like 180..265 CDD:467169
PDZ3_GRIP1-2-like 277..384 CDD:467172
degP_htrA_DO <491..659 CDD:273938
PDZ_canonical 572..>623 CDD:483948
PDZ6_GRIP1-2-like 830..914 CDD:467171
PDZ7_GRIP1-2-like 971..1056 CDD:467173
Dlg1XP_006521824.1 L27_1 6..64 CDD:462665
MAGUK_N_PEST 107..223 CDD:431391
PDZ1_Dlg1-2-4-like 222..310 CDD:467206 11/46 (24%)
PDZ2_Dlg1-2-4-like 319..403 CDD:467207
PDZ_assoc 404..465 CDD:463164
PDZ3_Dlg1-2-4-like 463..553 CDD:467257
SH3_DLG1 582..648 CDD:212964
Guanylate_kin 748..926 CDD:395500
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.