Sequence 1: | NP_572285.2 | Gene: | Grip / 50391 | FlyBaseID: | FBgn0029830 | Length: | 1058 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_446263.2 | Gene: | Slc9a3r2 / 116501 | RGDID: | 620380 | Length: | 337 | Species: | Rattus norvegicus |
Alignment Length: | 197 | Identity: | 45/197 - (22%) |
---|---|---|---|
Similarity: | 81/197 - (41%) | Gaps: | 14/197 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 864 VEGGIAHKNGQIHVGDQLLAIDEHSVQGMPLSHATSLLQNLGDLVDLKILRSHDLANGSHLPQTQ 928
Fly 929 -AIYAKVQRRPRSPSANTEASKE----SGS-GNANGGGAVNGNSGSGKPRVFHVTLYKDKVYDDY 987
Fly 988 GFSVSDGLYERGVFINRIRSGGPADMCGLLKPFDRIMQVNEMKTQDFDCCLTVPLIAAAGDKIEM 1052
Fly 1053 IM 1054 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Grip | NP_572285.2 | PDZ | 82..147 | CDD:294084 | |
PDZ_signaling | 183..254 | CDD:238492 | |||
PDZ_signaling | 278..375 | CDD:238492 | |||
PDZ | 496..>521 | CDD:294084 | |||
PDZ_signaling | 571..658 | CDD:238492 | |||
PDZ_signaling | 832..913 | CDD:238492 | 9/48 (19%) | ||
PDZ_signaling | 973..1055 | CDD:238492 | 19/82 (23%) | ||
Slc9a3r2 | NP_446263.2 | PDZ_signaling | 9..88 | CDD:238492 | 9/48 (19%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 127..146 | 8/18 (44%) | |||
PDZ_signaling | 149..228 | CDD:238492 | 21/84 (25%) | ||
EBP50_C | 232..337 | CDD:401087 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 246..337 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3528 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |