Sequence 1: | NP_001012747.1 | Gene: | DUXA / 503835 | HGNCID: | 32179 | Length: | 204 | Species: | Homo sapiens |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_524825.1 | Gene: | E5 / 45396 | FlyBaseID: | FBgn0008646 | Length: | 524 | Species: | Drosophila melanogaster |
Alignment Length: | 229 | Identity: | 45/229 - (19%) |
---|---|---|---|
Similarity: | 83/229 - (36%) | Gaps: | 79/229 - (34%) |
- Green bases have known domain annotations that are detailed below.
Human 16 RRCRTKFTEEQLKILINTFNQKPYPGYATKQKLALEINTEESRIQIWFQNRRARHGFQKRPEAET 80
Human 81 LESSQSQ--------------GQDQP-----------------------------------GVEF 96
Human 97 QSREARRCR----------------------TTYSASQLHTLIKAFMKNPYPGIDSREELAKEIG 139
Human 140 VPESRVQIWFQNRRSRLLLQRKREPVASLEQEEQ 173 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
DUXA | NP_001012747.1 | homeodomain | 16..74 | CDD:238039 | 20/57 (35%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 73..101 | 8/76 (11%) | |||
Homeobox | 105..155 | CDD:278475 | 8/71 (11%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 163..204 | 5/11 (45%) | |||
E5 | NP_524825.1 | Homeobox | 307..359 | CDD:278475 | 19/54 (35%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |