DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DUXA and E5

DIOPT Version :9

Sequence 1:NP_001012747.1 Gene:DUXA / 503835 HGNCID:32179 Length:204 Species:Homo sapiens
Sequence 2:NP_524825.1 Gene:E5 / 45396 FlyBaseID:FBgn0008646 Length:524 Species:Drosophila melanogaster


Alignment Length:229 Identity:45/229 - (19%)
Similarity:83/229 - (36%) Gaps:79/229 - (34%)


- Green bases have known domain annotations that are detailed below.


Human    16 RRCRTKFTEEQLKILINTFNQKPYPGYATKQKLALEINTEESRIQIWFQNRRARHGFQKRPEAET 80
            :|.||.|:..||..|.:.|....|...|.:::||..::..|:::::||||||.:|   ||.:.|.
  Fly   304 KRVRTAFSPTQLLKLEHAFEGNHYVVGAERKQLAQGLSLTETQVKVWFQNRRTKH---KRMQQEG 365

Human    81 LESSQSQ--------------GQDQP-----------------------------------GVEF 96
            .:.|.::              |:|..                                   |.|.
  Fly   366 GDGSDTKSNKGSSSGGGGGGDGEDDAKHDGSQHSYEDAEDPEDEDEIEEDDEDEVIDMDDYGSEM 430

Human    97 QSREARRCR----------------------TTYSASQLHTLIKAFMKNPYPGIDSREELAKEIG 139
            .:.|.:|.|                      .|.|..|.|.|::...::    :..:....::..
  Fly   431 DAEEHQRLREQFQQQLAQHQQQFMQQNAGEAATLSPQQQHQLLQQHQQH----LQQQHHQQQQHF 491

Human   140 VPESRVQIWFQNRRSRLLLQRKREPVASLEQEEQ 173
            :.:.: |::.:.|......:|:||...|.|:|.|
  Fly   492 IQQQQ-QLYLREREREREREREREREKSRERENQ 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DUXANP_001012747.1 homeodomain 16..74 CDD:238039 20/57 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..101 8/76 (11%)
Homeobox 105..155 CDD:278475 8/71 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..204 5/11 (45%)
E5NP_524825.1 Homeobox 307..359 CDD:278475 19/54 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.