DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL33 and MRPL39

DIOPT Version :10

Sequence 1:NP_524981.2 Gene:mRpL33 / 50381 FlyBaseID:FBgn0040907 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_013705.1 Gene:MRPL39 / 855002 SGDID:S000004468 Length:70 Species:Saccharomyces cerevisiae


Alignment Length:56 Identity:17/56 - (30%)
Similarity:32/56 - (57%) Gaps:1/56 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KVKSKR-IMVVLESVVSGHQFNAFRDRLADKLEIIRFDPYIQQESLYRERKKIRSA 64
            |||||. ::.:|.:..||:.......:.|..:..:|:||.:::..|::|.||.:.|
Yeast     3 KVKSKNSVIKLLSTAASGYSRYISIKKGAPLVTQVRYDPVVKRHVLFKEAKKRKVA 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL33NP_524981.2 None
MRPL39NP_013705.1 Ribosomal_L33 10..53 CDD:444877 9/42 (21%)

Return to query results.
Submit another query.