DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mRpL33 and Mrpl33

DIOPT Version :10

Sequence 1:NP_524981.2 Gene:mRpL33 / 50381 FlyBaseID:FBgn0040907 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_001385516.1 Gene:Mrpl33 / 100363539 RGDID:2322809 Length:65 Species:Rattus norvegicus


Alignment Length:64 Identity:29/64 - (45%)
Similarity:41/64 - (64%) Gaps:1/64 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRLTNVLFKKVKSKRIMVVLESVV-SGHQFNAFRDRLADKLEIIRFDPYIQQESLYRERKKIRS 63
            |.|:.|.|.|.|||.|:|.|.|.. :|..||..|.||.:||.::.:||.:.::.|:.|:|||||
  Rat     1 MLLSAVSFAKSKSKTILVKLVSQAGTGFSFNYKRSRLREKLTLLHYDPIVNKKVLFVEQKKIRS 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mRpL33NP_524981.2 None
Mrpl33NP_001385516.1 Ribosomal_L33 17..60 CDD:425701 15/42 (36%)

Return to query results.
Submit another query.