DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15578 and CG15577

DIOPT Version :9

Sequence 1:NP_652514.1 Gene:CG15578 / 50379 FlyBaseID:FBgn0040905 Length:89 Species:Drosophila melanogaster
Sequence 2:NP_652513.1 Gene:CG15577 / 50378 FlyBaseID:FBgn0040904 Length:99 Species:Drosophila melanogaster


Alignment Length:73 Identity:50/73 - (68%)
Similarity:60/73 - (82%) Gaps:1/73 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TLP-KRRLVPNLLKSIIMVLEHTSRPMTDTELNIFLGSQYQRNDPEFFAQVQINLHDGIESAILR 70
            ||| :|:||||||:||:.|||.|.|||:|.|||..||.||:||||||:.|||:||.||:|..||:
  Fly     9 TLPQQRKLVPNLLRSILRVLEETRRPMSDKELNFVLGVQYRRNDPEFYRQVQVNLRDGVEYGILK 73

  Fly    71 RQGNQISL 78
            |||||.||
  Fly    74 RQGNQFSL 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15578NP_652514.1 None
CG15577NP_652513.1 DUF4777 24..81 CDD:292626 37/56 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445029
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0014275
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.