powered by:
Protein Alignment CG15577 and CG15578
DIOPT Version :9
Sequence 1: | NP_652513.1 |
Gene: | CG15577 / 50378 |
FlyBaseID: | FBgn0040904 |
Length: | 99 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_652514.1 |
Gene: | CG15578 / 50379 |
FlyBaseID: | FBgn0040905 |
Length: | 89 |
Species: | Drosophila melanogaster |
Alignment Length: | 73 |
Identity: | 50/73 - (68%) |
Similarity: | 60/73 - (82%) |
Gaps: | 1/73 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 TLPQQRKLVPNLLRSILRVLEETRRPMSDKELNFVLGVQYRRNDPEFYRQVQVNLRDGVEYGILK 73
||| :|:||||||:||:.|||.|.|||:|.|||..||.||:||||||:.|||:||.||:|..||:
Fly 7 TLP-KRRLVPNLLKSIIMVLEHTSRPMTDTELNIFLGSQYQRNDPEFFAQVQINLHDGIESAILR 70
Fly 74 RQGNQFSL 81
|||||.||
Fly 71 RQGNQISL 78
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG15577 | NP_652513.1 |
DUF4777 |
24..81 |
CDD:292626 |
37/56 (66%) |
CG15578 | NP_652514.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45445029 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0014275 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.840 |
|
Return to query results.
Submit another query.