DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PEBP1 and a5

DIOPT Version :9

Sequence 1:NP_002558.1 Gene:PEBP1 / 5037 HGNCID:8630 Length:187 Species:Homo sapiens
Sequence 2:NP_476998.1 Gene:a5 / 33317 FlyBaseID:FBgn0011294 Length:210 Species:Drosophila melanogaster


Alignment Length:170 Identity:71/170 - (41%)
Similarity:103/170 - (60%) Gaps:2/170 - (1%)


- Green bases have known domain annotations that are detailed below.


Human    17 VDEQPQHPLHVTYAGAAVDELGKVLTPTQVKNRPTSISWDGLDSGKLYTLVLTDPDAPSRKDPKY 81
            :||.|:..|.:.|......|.||..|||::|.:| .:.|:. |....||:::..||||:|::|.|
  Fly    40 LDEPPRELLRIKYDNTIDIEEGKTYTPTELKFQP-RLDWNA-DPESFYTVLMICPDAPNRENPMY 102

Human    82 REWHHFLVVNMKGNDISSGTVLSDYVGSGPPKGTGLHRYVWLVYEQDRPLKCDEPILSNRSGDHR 146
            |.|.|:||||:.|.||..|..:|:|.|..|||.:|:.||:.|||:|...|..||..:...:.|..
  Fly   103 RSWLHWLVVNVPGLDIMKGQPISEYFGPLPPKDSGIQRYLILVYQQSDKLDFDEKKMELSNADGH 167

Human   147 GKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSG 186
            ..|.|..|.:|||:.:||||..:|:.||:|||:|.:.|.|
  Fly   168 SNFDVMKFTQKYEMGSPVAGNIFQSRWDEYVPELMKTLYG 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PEBP1NP_002558.1 PEBP_euk 23..171 CDD:176644 59/147 (40%)
Interaction with RAF1. /evidence=ECO:0000269|PubMed:18294816 93..134 18/40 (45%)
a5NP_476998.1 PEBP_euk 47..192 CDD:176644 59/146 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149348
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1881
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55789
OrthoDB 1 1.010 - - D1557122at2759
OrthoFinder 1 1.000 - - FOG0000438
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X275
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.720

Return to query results.
Submit another query.