DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13364 and TMA7

DIOPT Version :9

Sequence 1:NP_652500.1 Gene:CG13364 / 50364 FlyBaseID:FBgn0026879 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_013364.1 Gene:TMA7 / 850967 SGDID:S000007246 Length:64 Species:Saccharomyces cerevisiae


Alignment Length:64 Identity:39/64 - (60%)
Similarity:45/64 - (70%) Gaps:0/64 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGREGGKKKPLKAPKKDSKDLDEDDMAFKQKQKEQQKALEAAKANASKKGPLVGGGIKKSGKK 64
            ||.|:|||.||||..||..:|||.:|:|||:|||....|.:|..||.....|||||||||||||
Yeast     1 MSSRQGGKMKPLKQKKKQQQDLDPEDIAFKEKQKADAAAKKALMANMKSGKPLVGGGIKKSGKK 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13364NP_652500.1 TMA7 3..54 CDD:401131 25/50 (50%)
TMA7NP_013364.1 TMA7 3..59 CDD:401131 30/55 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55999
OrthoFinder 1 1.000 - - FOG0002680
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105239
Panther 1 1.100 - - LDO PTHR28632
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2447
TreeFam 00.000 Not matched by this tool.
76.820

Return to query results.
Submit another query.