powered by:
Protein Alignment CG13364 and TMA7
DIOPT Version :9
Sequence 1: | NP_652500.1 |
Gene: | CG13364 / 50364 |
FlyBaseID: | FBgn0026879 |
Length: | 64 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_013364.1 |
Gene: | TMA7 / 850967 |
SGDID: | S000007246 |
Length: | 64 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 64 |
Identity: | 39/64 - (60%) |
Similarity: | 45/64 - (70%) |
Gaps: | 0/64 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSGREGGKKKPLKAPKKDSKDLDEDDMAFKQKQKEQQKALEAAKANASKKGPLVGGGIKKSGKK 64
||.|:|||.||||..||..:|||.:|:|||:|||....|.:|..||.....|||||||||||||
Yeast 1 MSSRQGGKMKPLKQKKKQQQDLDPEDIAFKEKQKADAAAKKALMANMKSGKPLVGGGIKKSGKK 64
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG13364 | NP_652500.1 |
TMA7 |
3..54 |
CDD:401131 |
25/50 (50%) |
TMA7 | NP_013364.1 |
TMA7 |
3..59 |
CDD:401131 |
30/55 (55%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4766 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
1 |
1.010 |
- |
- |
|
QHG55999 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0002680 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_105239 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR28632 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X2447 |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
7 | 6.820 |
|
Return to query results.
Submit another query.