powered by:
Protein Alignment CG13364 and AT3G16040
DIOPT Version :9
Sequence 1: | NP_652500.1 |
Gene: | CG13364 / 50364 |
FlyBaseID: | FBgn0026879 |
Length: | 64 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_566533.1 |
Gene: | AT3G16040 / 820849 |
AraportID: | AT3G16040 |
Length: | 64 |
Species: | Arabidopsis thaliana |
Alignment Length: | 64 |
Identity: | 35/64 - (54%) |
Similarity: | 46/64 - (71%) |
Gaps: | 0/64 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSGREGGKKKPLKAPKKDSKDLDEDDMAFKQKQKEQQKALEAAKANASKKGPLVGGGIKKSGKK 64
||.::|||.||||.||...|:.||.||...||:|:::|||:..:|.||:||...|.|:||||||
plant 1 MSSKQGGKLKPLKQPKSGKKEYDEHDMELMQKKKDEEKALKELRAKASQKGSFGGSGLKKSGKK 64
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG13364 | NP_652500.1 |
TMA7 |
3..54 |
CDD:401131 |
25/50 (50%) |
AT3G16040 | NP_566533.1 |
TMA7 |
3..64 |
CDD:401131 |
31/60 (52%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4766 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
1 |
1.010 |
- |
- |
|
QHG55999 |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0002680 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_105239 |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR28632 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
7 | 6.780 |
|
Return to query results.
Submit another query.