DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13364 and AT3G16040

DIOPT Version :9

Sequence 1:NP_652500.1 Gene:CG13364 / 50364 FlyBaseID:FBgn0026879 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_566533.1 Gene:AT3G16040 / 820849 AraportID:AT3G16040 Length:64 Species:Arabidopsis thaliana


Alignment Length:64 Identity:35/64 - (54%)
Similarity:46/64 - (71%) Gaps:0/64 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGREGGKKKPLKAPKKDSKDLDEDDMAFKQKQKEQQKALEAAKANASKKGPLVGGGIKKSGKK 64
            ||.::|||.||||.||...|:.||.||...||:|:::|||:..:|.||:||...|.|:||||||
plant     1 MSSKQGGKLKPLKQPKSGKKEYDEHDMELMQKKKDEEKALKELRAKASQKGSFGGSGLKKSGKK 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13364NP_652500.1 TMA7 3..54 CDD:401131 25/50 (50%)
AT3G16040NP_566533.1 TMA7 3..64 CDD:401131 31/60 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4766
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55999
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002680
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105239
Panther 1 1.100 - - O PTHR28632
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.