DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13364 and Tma7

DIOPT Version :10

Sequence 1:NP_652500.1 Gene:CG13364 / 50364 FlyBaseID:FBgn0026879 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_899073.1 Gene:Tma7 / 66167 MGIID:1913417 Length:64 Species:Mus musculus


Alignment Length:64 Identity:48/64 - (75%)
Similarity:54/64 - (84%) Gaps:0/64 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGREGGKKKPLKAPKKDSKDLDEDDMAFKQKQKEQQKALEAAKANASKKGPLVGGGIKKSGKK 64
            |||||||||||||.|||.:|::||:|.||||||||:||.||..||.|:.||||..|||||||||
Mouse     1 MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKGPLATGGIKKSGKK 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13364NP_652500.1 TMA7 3..54 CDD:462671 36/50 (72%)
Tma7NP_899073.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..64 46/62 (74%)
TMA7 3..64 CDD:462671 44/60 (73%)

Return to query results.
Submit another query.