DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13364 and CG16824

DIOPT Version :9

Sequence 1:NP_652500.1 Gene:CG13364 / 50364 FlyBaseID:FBgn0026879 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_001097158.1 Gene:CG16824 / 5740834 FlyBaseID:FBgn0040973 Length:64 Species:Drosophila melanogaster


Alignment Length:64 Identity:58/64 - (90%)
Similarity:63/64 - (98%) Gaps:0/64 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGREGGKKKPLKAPKKDSKDLDEDDMAFKQKQKEQQKALEAAKANASKKGPLVGGGIKKSGKK 64
            |:||||||||||||||||||:|||:||||||||||||||:|||||.|||||||:||||||||||
  Fly     1 MAGREGGKKKPLKAPKKDSKNLDEEDMAFKQKQKEQQKAMEAAKAGASKKGPLLGGGIKKSGKK 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13364NP_652500.1 TMA7 3..54 CDD:401131 46/50 (92%)
CG16824NP_001097158.1 TMA7 3..53 CDD:286198 45/49 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458952
Domainoid 1 1.000 106 1.000 Domainoid score I6507
eggNOG 1 0.900 - - E1_KOG4766
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 109 1.000 Inparanoid score I4875
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55999
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002680
OrthoInspector 1 1.000 - - otm42709
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR28632
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2447
109.900

Return to query results.
Submit another query.