powered by:
Protein Alignment CG13364 and CG16824
DIOPT Version :9
Sequence 1: | NP_652500.1 |
Gene: | CG13364 / 50364 |
FlyBaseID: | FBgn0026879 |
Length: | 64 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097158.1 |
Gene: | CG16824 / 5740834 |
FlyBaseID: | FBgn0040973 |
Length: | 64 |
Species: | Drosophila melanogaster |
Alignment Length: | 64 |
Identity: | 58/64 - (90%) |
Similarity: | 63/64 - (98%) |
Gaps: | 0/64 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSGREGGKKKPLKAPKKDSKDLDEDDMAFKQKQKEQQKALEAAKANASKKGPLVGGGIKKSGKK 64
|:||||||||||||||||||:|||:||||||||||||||:|||||.|||||||:||||||||||
Fly 1 MAGREGGKKKPLKAPKKDSKNLDEEDMAFKQKQKEQQKAMEAAKAGASKKGPLLGGGIKKSGKK 64
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG13364 | NP_652500.1 |
TMA7 |
3..54 |
CDD:401131 |
46/50 (92%) |
CG16824 | NP_001097158.1 |
TMA7 |
3..53 |
CDD:286198 |
45/49 (92%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45458952 |
Domainoid |
1 |
1.000 |
106 |
1.000 |
Domainoid score |
I6507 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4766 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
109 |
1.000 |
Inparanoid score |
I4875 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
1 |
1.010 |
- |
- |
|
QHG55999 |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0002680 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm42709 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR28632 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X2447 |
|
10 | 9.900 |
|
Return to query results.
Submit another query.