Sequence 1: | NP_652500.1 | Gene: | CG13364 / 50364 | FlyBaseID: | FBgn0026879 | Length: | 64 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_057017.1 | Gene: | TMA7 / 51372 | HGNCID: | 26932 | Length: | 64 | Species: | Homo sapiens |
Alignment Length: | 64 | Identity: | 48/64 - (75%) |
---|---|---|---|
Similarity: | 54/64 - (84%) | Gaps: | 0/64 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSGREGGKKKPLKAPKKDSKDLDEDDMAFKQKQKEQQKALEAAKANASKKGPLVGGGIKKSGKK 64 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13364 | NP_652500.1 | TMA7 | 3..54 | CDD:401131 | 36/50 (72%) |
TMA7 | NP_057017.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..64 | 46/62 (74%) | |
TMA7 | 3..64 | CDD:401131 | 44/60 (73%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4766 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 100 | 1.000 | Inparanoid score | I5002 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG55999 | |
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0002680 | |
OrthoInspector | 1 | 1.000 | - | - | otm40634 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_105239 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR28632 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R6350 |
SonicParanoid | 1 | 1.000 | - | - | X2447 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
12 | 11.860 |