DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13364 and TMA7

DIOPT Version :9

Sequence 1:NP_652500.1 Gene:CG13364 / 50364 FlyBaseID:FBgn0026879 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_057017.1 Gene:TMA7 / 51372 HGNCID:26932 Length:64 Species:Homo sapiens


Alignment Length:64 Identity:48/64 - (75%)
Similarity:54/64 - (84%) Gaps:0/64 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGREGGKKKPLKAPKKDSKDLDEDDMAFKQKQKEQQKALEAAKANASKKGPLVGGGIKKSGKK 64
            |||||||||||||.|||.:|::||:|.||||||||:||.||..||.|:.||||..|||||||||
Human     1 MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKGPLATGGIKKSGKK 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13364NP_652500.1 TMA7 3..54 CDD:401131 36/50 (72%)
TMA7NP_057017.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..64 46/62 (74%)
TMA7 3..64 CDD:401131 44/60 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4766
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I5002
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55999
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002680
OrthoInspector 1 1.000 - - otm40634
orthoMCL 1 0.900 - - OOG6_105239
Panther 1 1.100 - - LDO PTHR28632
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6350
SonicParanoid 1 1.000 - - X2447
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.860

Return to query results.
Submit another query.