DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13364 and TMA7B

DIOPT Version :10

Sequence 1:NP_652500.1 Gene:CG13364 / 50364 FlyBaseID:FBgn0026879 Length:64 Species:Drosophila melanogaster
Sequence 2:NP_001382942.1 Gene:TMA7B / 112268293 HGNCID:53893 Length:64 Species:Homo sapiens


Alignment Length:64 Identity:43/64 - (67%)
Similarity:49/64 - (76%) Gaps:0/64 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGREGGKKKPLKAPKKDSKDLDEDDMAFKQKQKEQQKALEAAKANASKKGPLVGGGIKKSGKK 64
            ||..||||||.||.|||.:|::||::.||||||||:||.||..||....||||..|||||||||
Human     1 MSSHEGGKKKALKQPKKQAKEMDEEEKAFKQKQKEEQKKLEVLKAKVVGKGPLATGGIKKSGKK 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13364NP_652500.1 TMA7 3..54 CDD:462671 31/50 (62%)
TMA7BNP_001382942.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38 24/36 (67%)
TMA7 3..64 CDD:462671 39/60 (65%)

Return to query results.
Submit another query.