DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13364 and LOC100910678

DIOPT Version :9

Sequence 1:NP_652500.1 Gene:CG13364 / 50364 FlyBaseID:FBgn0026879 Length:64 Species:Drosophila melanogaster
Sequence 2:XP_038964599.1 Gene:LOC100910678 / 100910678 RGDID:6497475 Length:64 Species:Rattus norvegicus


Alignment Length:64 Identity:48/64 - (75%)
Similarity:53/64 - (82%) Gaps:0/64 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSGREGGKKKPLKAPKKDSKDLDEDDMAFKQKQKEQQKALEAAKANASKKGPLVGGGIKKSGKK 64
            |||||||||||||.|||.:|::||:|.||||||||:||.||..||.|..||||..|||||||||
  Rat     1 MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAEGKGPLATGGIKKSGKK 64

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13364NP_652500.1 TMA7 3..54 CDD:401131 36/50 (72%)
LOC100910678XP_038964599.1 TMA7 3..64 CDD:401131 44/60 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I4894
OMA 1 1.010 - - QHG55999
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002680
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105239
Panther 1 1.100 - - O PTHR28632
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2447
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.