powered by:
Protein Alignment ksh and AT5G20165
DIOPT Version :9
Sequence 1: | NP_652499.2 |
Gene: | ksh / 50363 |
FlyBaseID: | FBgn0040890 |
Length: | 72 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001318607.1 |
Gene: | AT5G20165 / 832139 |
AraportID: | AT5G20165 |
Length: | 91 |
Species: | Arabidopsis thaliana |
Alignment Length: | 72 |
Identity: | 32/72 - (44%) |
Similarity: | 41/72 - (56%) |
Gaps: | 24/72 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSALFNFHSLLSVILLLICTCAYLRSLFPSLIDRNKTG-----------------------FMGT 42
|||||||||.|:|:||:||||.||:..||::::: ||| |.|.
plant 1 MSALFNFHSFLTVVLLVICTCTYLKMQFPAILEQ-KTGIVFCQIKDALSDFSAYCYFRLQMFRGF 64
Fly 43 FWKLARI 49
|||.|||
plant 65 FWKAARI 71
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
ksh | NP_652499.2 |
DUF1242 |
<19..44 |
CDD:284305 |
12/47 (26%) |
AT5G20165 | NP_001318607.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3808 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
58 |
1.000 |
Inparanoid score |
I2573 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1596132at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001976 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_102262 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR13229 |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
1 |
1.000 |
- |
- |
|
X3223 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
9 | 8.870 |
|
Return to query results.
Submit another query.