DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ksh and Tmem167

DIOPT Version :9

Sequence 1:NP_652499.2 Gene:ksh / 50363 FlyBaseID:FBgn0040890 Length:72 Species:Drosophila melanogaster
Sequence 2:NP_079611.2 Gene:Tmem167 / 66074 MGIID:1913324 Length:72 Species:Mus musculus


Alignment Length:70 Identity:51/70 - (72%)
Similarity:62/70 - (88%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSALFNFHSLLSVILLLICTCAYLRSLFPSLIDRNKTGFMGTFWKLARIGERKSPWVGAACLIMA 65
            |||:|||.|||:|||||||||||:|||.||::||||||.:|.|||.|||||||||:|...|::||
Mouse     1 MSAIFNFQSLLTVILLLICTCAYIRSLAPSILDRNKTGLLGIFWKCARIGERKSPYVAICCIVMA 65

  Fly    66 FTVLF 70
            |::||
Mouse    66 FSILF 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kshNP_652499.2 DUF1242 <19..44 CDD:284305 17/24 (71%)
Tmem167NP_079611.2 DUF1242 10..44 CDD:399673 25/33 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167836072
Domainoid 1 1.000 63 1.000 Domainoid score I10239
eggNOG 1 0.900 - - E1_KOG3808
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41626
Inparanoid 1 1.050 115 1.000 Inparanoid score I4822
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53568
OrthoDB 1 1.010 - - D1596132at2759
OrthoFinder 1 1.000 - - FOG0001976
OrthoInspector 1 1.000 - - oto93222
orthoMCL 1 0.900 - - OOG6_102262
Panther 1 1.100 - - LDO PTHR13229
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R639
SonicParanoid 1 1.000 - - X3223
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1716.800

Return to query results.
Submit another query.