DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ksh and tmem167b

DIOPT Version :9

Sequence 1:NP_652499.2 Gene:ksh / 50363 FlyBaseID:FBgn0040890 Length:72 Species:Drosophila melanogaster
Sequence 2:NP_001016348.1 Gene:tmem167b / 549102 XenbaseID:XB-GENE-5821110 Length:74 Species:Xenopus tropicalis


Alignment Length:72 Identity:29/72 - (40%)
Similarity:39/72 - (54%) Gaps:2/72 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSALFNFHSLLSVILLLICTCAYLRSL--FPSLIDRNKTGFMGTFWKLARIGERKSPWVGAACLI 63
            |:.:::...||...||.:|||||.|.:  ..|.:...|.|..|.|:|.|.||.|....|..:|:.
 Frog     1 MTNVYSLDGLLVFALLFVCTCAYFRKVPRLRSWLLSEKKGVWGVFYKAAVIGSRLHLAVSISCIA 65

  Fly    64 MAFTVLF 70
            |||.|||
 Frog    66 MAFYVLF 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kshNP_652499.2 DUF1242 <19..44 CDD:284305 10/26 (38%)
tmem167bNP_001016348.1 DUF1242 10..46 CDD:369105 14/35 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1596132at2759
OrthoFinder 1 1.000 - - FOG0001976
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.