powered by:
Protein Alignment ksh and tmem167b
DIOPT Version :9
Sequence 1: | NP_652499.2 |
Gene: | ksh / 50363 |
FlyBaseID: | FBgn0040890 |
Length: | 72 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001016348.1 |
Gene: | tmem167b / 549102 |
XenbaseID: | XB-GENE-5821110 |
Length: | 74 |
Species: | Xenopus tropicalis |
Alignment Length: | 72 |
Identity: | 29/72 - (40%) |
Similarity: | 39/72 - (54%) |
Gaps: | 2/72 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSALFNFHSLLSVILLLICTCAYLRSL--FPSLIDRNKTGFMGTFWKLARIGERKSPWVGAACLI 63
|:.:::...||...||.:|||||.|.: ..|.:...|.|..|.|:|.|.||.|....|..:|:.
Frog 1 MTNVYSLDGLLVFALLFVCTCAYFRKVPRLRSWLLSEKKGVWGVFYKAAVIGSRLHLAVSISCIA 65
Fly 64 MAFTVLF 70
|||.|||
Frog 66 MAFYVLF 72
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1596132at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001976 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.920 |
|
Return to query results.
Submit another query.