DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ksh and tmem167a

DIOPT Version :9

Sequence 1:NP_652499.2 Gene:ksh / 50363 FlyBaseID:FBgn0040890 Length:72 Species:Drosophila melanogaster
Sequence 2:NP_001018875.2 Gene:tmem167a / 541340 ZFINID:ZDB-GENE-050320-29 Length:72 Species:Danio rerio


Alignment Length:70 Identity:53/70 - (75%)
Similarity:63/70 - (90%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSALFNFHSLLSVILLLICTCAYLRSLFPSLIDRNKTGFMGTFWKLARIGERKSPWVGAACLIMA 65
            |||:|||.|||:|||||||||||:|||.|||:|:|||||:|.|||.|||||||||:|...|::||
Zfish     1 MSAIFNFQSLLTVILLLICTCAYIRSLTPSLLDKNKTGFLGIFWKCARIGERKSPYVAFCCIVMA 65

  Fly    66 FTVLF 70
            ||:||
Zfish    66 FTILF 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kshNP_652499.2 DUF1242 <19..44 CDD:284305 18/24 (75%)
tmem167aNP_001018875.2 DUF1242 10..44 CDD:284305 26/33 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579520
Domainoid 1 1.000 65 1.000 Domainoid score I10065
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41626
Inparanoid 1 1.050 116 1.000 Inparanoid score I4797
OMA 1 1.010 - - QHG53568
OrthoDB 1 1.010 - - D1596132at2759
OrthoFinder 1 1.000 - - FOG0001976
OrthoInspector 1 1.000 - - oto41714
orthoMCL 1 0.900 - - OOG6_102262
Panther 1 1.100 - - LDO PTHR13229
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R639
SonicParanoid 1 1.000 - - X3223
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.900

Return to query results.
Submit another query.