DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ksh and Tmem167b

DIOPT Version :9

Sequence 1:NP_652499.2 Gene:ksh / 50363 FlyBaseID:FBgn0040890 Length:72 Species:Drosophila melanogaster
Sequence 2:NP_001128732.1 Gene:Tmem167b / 499690 RGDID:1564454 Length:74 Species:Rattus norvegicus


Alignment Length:73 Identity:29/73 - (39%)
Similarity:41/73 - (56%) Gaps:4/73 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSALFNFHSLLSVILLLICTCAYLRSLFPSL---IDRNKTGFMGTFWKLARIGERKSPWVGAACL 62
            |:.:::...:|...||.:|||||.:.: |.|   :...|.|..|.|:|.|.||.|....|..||:
  Rat     1 MTNVYSLDGILVFGLLFVCTCAYFKKV-PRLKTWLLSEKKGVWGVFYKAAVIGTRLHAAVAIACI 64

  Fly    63 IMAFTVLF 70
            :|||.|||
  Rat    65 VMAFYVLF 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kshNP_652499.2 DUF1242 <19..44 CDD:284305 10/27 (37%)
Tmem167bNP_001128732.1 DUF1242 11..46 CDD:399673 13/35 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3808
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1596132at2759
OrthoFinder 1 1.000 - - FOG0001976
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102262
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.