DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ksh and ksh

DIOPT Version :10

Sequence 1:NP_652499.2 Gene:ksh / 50363 FlyBaseID:FBgn0040890 Length:72 Species:Drosophila melanogaster
Sequence 2:XP_550715.2 Gene:ksh / 3290556 VectorBaseID:AGAMI1_014558 Length:72 Species:Anopheles gambiae


Alignment Length:72 Identity:54/72 - (75%)
Similarity:64/72 - (88%) Gaps:0/72 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSALFNFHSLLSVILLLICTCAYLRSLFPSLIDRNKTGFMGTFWKLARIGERKSPWVGAACLIMA 65
            |||:|||.|||||:|||||||.||||||||::||||||.:|.|||.||:||||||:|..|||:||
Mosquito     1 MSAIFNFQSLLSVLLLLICTCTYLRSLFPSIVDRNKTGMLGLFWKFARVGERKSPYVSFACLVMA 65

  Fly    66 FTVLFWS 72
            .::||||
Mosquito    66 VSILFWS 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kshNP_652499.2 DUF1242 <19..44 CDD:462019 18/24 (75%)
kshXP_550715.2 DUF1242 <18..44 CDD:462019 19/25 (76%)

Return to query results.
Submit another query.