powered by:
Protein Alignment ksh and popl-7
DIOPT Version :9
Sequence 1: | NP_652499.2 |
Gene: | ksh / 50363 |
FlyBaseID: | FBgn0040890 |
Length: | 72 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001368694.1 |
Gene: | popl-7 / 178298 |
WormBaseID: | WBGene00013373 |
Length: | 78 |
Species: | Caenorhabditis elegans |
Alignment Length: | 70 |
Identity: | 48/70 - (68%) |
Similarity: | 56/70 - (80%) |
Gaps: | 0/70 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSALFNFHSLLSVILLLICTCAYLRSLFPSLIDRNKTGFMGTFWKLARIGERKSPWVGAACLIMA 65
:||:|||.||:||||||||||||:|:..|.:|||||.|.:|.|||.||||||.||||..:|..||
Worm 8 LSAIFNFQSLISVILLLICTCAYIRAFAPRIIDRNKEGLLGVFWKCARIGERLSPWVSISCFCMA 72
Fly 66 FTVLF 70
|.|||
Worm 73 FVVLF 77
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160158770 |
Domainoid |
1 |
1.000 |
58 |
1.000 |
Domainoid score |
I7168 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
107 |
1.000 |
Inparanoid score |
I3494 |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
1 |
1.010 |
- |
- |
|
QHG53568 |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001976 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto19697 |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_102262 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X3223 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
10 | 9.800 |
|
Return to query results.
Submit another query.