DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ksh and popl-7

DIOPT Version :9

Sequence 1:NP_652499.2 Gene:ksh / 50363 FlyBaseID:FBgn0040890 Length:72 Species:Drosophila melanogaster
Sequence 2:NP_001368694.1 Gene:popl-7 / 178298 WormBaseID:WBGene00013373 Length:78 Species:Caenorhabditis elegans


Alignment Length:70 Identity:48/70 - (68%)
Similarity:56/70 - (80%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSALFNFHSLLSVILLLICTCAYLRSLFPSLIDRNKTGFMGTFWKLARIGERKSPWVGAACLIMA 65
            :||:|||.||:||||||||||||:|:..|.:|||||.|.:|.|||.||||||.||||..:|..||
 Worm     8 LSAIFNFQSLISVILLLICTCAYIRAFAPRIIDRNKEGLLGVFWKCARIGERLSPWVSISCFCMA 72

  Fly    66 FTVLF 70
            |.|||
 Worm    73 FVVLF 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kshNP_652499.2 DUF1242 <19..44 CDD:284305 14/24 (58%)
popl-7NP_001368694.1 DUF1242 17..51 CDD:399673 22/33 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158770
Domainoid 1 1.000 58 1.000 Domainoid score I7168
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 107 1.000 Inparanoid score I3494
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53568
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001976
OrthoInspector 1 1.000 - - oto19697
orthoMCL 1 0.900 - - OOG6_102262
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3223
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.800

Return to query results.
Submit another query.