DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ksh and K07F5.22

DIOPT Version :9

Sequence 1:NP_652499.2 Gene:ksh / 50363 FlyBaseID:FBgn0040890 Length:72 Species:Drosophila melanogaster
Sequence 2:NP_001370130.1 Gene:K07F5.22 / 177838 WormBaseID:WBGene00303023 Length:73 Species:Caenorhabditis elegans


Alignment Length:69 Identity:29/69 - (42%)
Similarity:38/69 - (55%) Gaps:2/69 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LFNFHSLLSVILLLICTCAYLRSL--FPSLIDRNKTGFMGTFWKLARIGERKSPWVGAACLIMAF 66
            :::|..|:...||.|||||||:.:  ..|.:...|.||.|.|:|.|.||.|....|..:||..|.
 Worm     3 VYSFDGLVVAALLFICTCAYLKRVPRVSSWLLSEKKGFFGVFYKAAVIGVRLHSLVALSCLSAAV 67

  Fly    67 TVLF 70
            .|||
 Worm    68 YVLF 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kshNP_652499.2 DUF1242 <19..44 CDD:284305 11/26 (42%)
K07F5.22NP_001370130.1 DUF1242 9..45 CDD:399673 15/35 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001976
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_102262
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.