powered by:
Protein Alignment ksh and K07F5.22
DIOPT Version :9
Sequence 1: | NP_652499.2 |
Gene: | ksh / 50363 |
FlyBaseID: | FBgn0040890 |
Length: | 72 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001370130.1 |
Gene: | K07F5.22 / 177838 |
WormBaseID: | WBGene00303023 |
Length: | 73 |
Species: | Caenorhabditis elegans |
Alignment Length: | 69 |
Identity: | 29/69 - (42%) |
Similarity: | 38/69 - (55%) |
Gaps: | 2/69 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 LFNFHSLLSVILLLICTCAYLRSL--FPSLIDRNKTGFMGTFWKLARIGERKSPWVGAACLIMAF 66
:::|..|:...||.|||||||:.: ..|.:...|.||.|.|:|.|.||.|....|..:||..|.
Worm 3 VYSFDGLVVAALLFICTCAYLKRVPRVSSWLLSEKKGFFGVFYKAAVIGVRLHSLVALSCLSAAV 67
Fly 67 TVLF 70
.|||
Worm 68 YVLF 71
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001976 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_102262 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.810 |
|
Return to query results.
Submit another query.