DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ksh and KSH1

DIOPT Version :9

Sequence 1:NP_652499.2 Gene:ksh / 50363 FlyBaseID:FBgn0040890 Length:72 Species:Drosophila melanogaster
Sequence 2:NP_878158.3 Gene:KSH1 / 1466516 SGDID:S000028698 Length:72 Species:Saccharomyces cerevisiae


Alignment Length:68 Identity:41/68 - (60%)
Similarity:53/68 - (77%) Gaps:1/68 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSALFNFHSLLSVILLLICTCAYLRSLFPSLIDRNKT-GFMGTFWKLARIGERKSPWVGAACLIM 64
            |||||||.|||.|||||||:|:|:...:|||:||.|. ..:|.|||:||:|||.||:|..||::|
Yeast     1 MSALFNFRSLLQVILLLICSCSYVHGQWPSLLDRYKNHEVLGAFWKMARVGERASPYVSLACILM 65

  Fly    65 AFT 67
            |.:
Yeast    66 AIS 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kshNP_652499.2 DUF1242 <19..44 CDD:284305 10/25 (40%)
KSH1NP_878158.3 DUF1242 10..45 CDD:399673 18/34 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343446
Domainoid 1 1.000 43 1.000 Domainoid score I3184
eggNOG 1 0.900 - - E1_KOG3808
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 88 1.000 Inparanoid score I1569
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53568
OrthoFinder 1 1.000 - - FOG0001976
OrthoInspector 1 1.000 - - oto99490
orthoMCL 1 0.900 - - OOG6_102262
Panther 1 1.100 - - LDO PTHR13229
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R639
SonicParanoid 1 1.000 - - X3223
TreeFam 1 0.960 - -
1413.790

Return to query results.
Submit another query.