DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12994 and CG17193

DIOPT Version :9

Sequence 1:NP_652488.1 Gene:CG12994 / 50350 FlyBaseID:FBgn0040877 Length:67 Species:Drosophila melanogaster
Sequence 2:NP_001163659.1 Gene:CG17193 / 50044 FlyBaseID:FBgn0040571 Length:68 Species:Drosophila melanogaster


Alignment Length:65 Identity:45/65 - (69%)
Similarity:54/65 - (83%) Gaps:2/65 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GRVAGKAGYS-NHYYNGRSYVGINEEIMWVSIGMGVTIVLLITIALCYIAREKCQKRQREYYVTA 67
            ||.|||.||| |:||:|.||..||:||:.|||.||:||::||||||||||.|||||: ||||:.|
  Fly     5 GRTAGKYGYSDNNYYSGHSYKSINDEIILVSIIMGITILVLITIALCYIAYEKCQKK-REYYINA 68

  Fly    68  67
              Fly    69  68



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445025
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C74A
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27299
OrthoDB 1 1.010 - - D77115at7147
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm50982
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.