powered by:
Protein Alignment CG12994 and CG17193
DIOPT Version :9
Sequence 1: | NP_652488.1 |
Gene: | CG12994 / 50350 |
FlyBaseID: | FBgn0040877 |
Length: | 67 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001163659.1 |
Gene: | CG17193 / 50044 |
FlyBaseID: | FBgn0040571 |
Length: | 68 |
Species: | Drosophila melanogaster |
Alignment Length: | 65 |
Identity: | 45/65 - (69%) |
Similarity: | 54/65 - (83%) |
Gaps: | 2/65 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 GRVAGKAGYS-NHYYNGRSYVGINEEIMWVSIGMGVTIVLLITIALCYIAREKCQKRQREYYVTA 67
||.|||.||| |:||:|.||..||:||:.|||.||:||::||||||||||.|||||: ||||:.|
Fly 5 GRTAGKYGYSDNNYYSGHSYKSINDEIILVSIIMGITILVLITIALCYIAYEKCQKK-REYYINA 68
Fly 68 67
Fly 69 68
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45445025 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2C74A |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
1 |
1.010 |
- |
- |
|
QHG27299 |
OrthoDB |
1 |
1.010 |
- |
- |
|
D77115at7147 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm50982 |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
6 | 5.760 |
|
Return to query results.
Submit another query.