powered by:
Protein Alignment CG12994 and mex1
DIOPT Version :9
Sequence 1: | NP_652488.1 |
Gene: | CG12994 / 50350 |
FlyBaseID: | FBgn0040877 |
Length: | 67 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001189110.1 |
Gene: | mex1 / 39677 |
FlyBaseID: | FBgn0004228 |
Length: | 83 |
Species: | Drosophila melanogaster |
Alignment Length: | 34 |
Identity: | 7/34 - (20%) |
Similarity: | 18/34 - (52%) |
Gaps: | 0/34 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 29 IMWVSIGMGVTIVLLITIALCYIAREKCQKRQRE 62
|::.::.|.|.|.|::...:.|...:...:.|::
Fly 30 IVFSALLMVVVIGLIVYFTVFYHKDKNTDEVQKQ 63
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0.928771 |
Normalized mean entropy |
S12684 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.