DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12479 and micos10

DIOPT Version :10

Sequence 1:NP_652484.1 Gene:CG12479 / 50344 FlyBaseID:FBgn0040871 Length:74 Species:Drosophila melanogaster
Sequence 2:NP_001136427.1 Gene:micos10 / 751699 ZFINID:ZDB-GENE-060825-325 Length:76 Species:Danio rerio


Alignment Length:60 Identity:26/60 - (43%)
Similarity:40/60 - (66%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EDRLRENINRCLSDSLVKGVGGLVIGSVVTLLFFRRRIWPVWLGTGFGVGVAYRGCEKEL 65
            |..|.:..:|||:|..:|...||.:|.|.:::||:||..|:.||||.|:|:||..|:.:|
Zfish     3 EKELGQKWDRCLADCAIKVGTGLGLGIVFSVVFFKRRTSPIALGTGIGLGMAYSNCQNDL 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12479NP_652484.1 DUF543 1..66 CDD:461300 26/60 (43%)
micos10NP_001136427.1 DUF543 1..63 CDD:461300 26/60 (43%)

Return to query results.
Submit another query.