DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P4HB and CaBP1

DIOPT Version :9

Sequence 1:XP_024306545.1 Gene:P4HB / 5034 HGNCID:8548 Length:546 Species:Homo sapiens
Sequence 2:NP_001285979.1 Gene:CaBP1 / 34976 FlyBaseID:FBgn0025678 Length:433 Species:Drosophila melanogaster


Alignment Length:286 Identity:85/286 - (29%)
Similarity:124/286 - (43%) Gaps:68/286 - (23%)


- Green bases have known domain annotations that are detailed below.


Human    24 DHVLVLRKSNFAE-ALAAHKYLLVEFYAPWCGHCKALAPEYAKAAGKLKAEGSEIRLAKVDATEE 87
            |.|:.|.:.||.: .|.:....||||:||||||||.||||:||||.:||   .:::|..:|||..
  Fly   156 DDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAKELK---GKVKLGALDATAH 217

Human    88 SDLAQQYGVRGYPTIKFFRNGD--TASPKEYTAGREADDIVNWLKKR-----TGPAATTLPDGAA 145
            ...|.:|.||||||||||..|.  .:..:||..||.|.|||:|...:     ..|....:.:.:.
  Fly   218 QSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIVSWASDKHVANVPAPELIEIINEST 282

Human   146 AESLVESSEVAVIGFFKDVESDSAK-----------------------------QFLQAAEAIDD 181
            .|:..|...:.|:.....:....||                             |.|...|:::.
  Fly   283 FETACEGKPLCVVSVLPHILDCDAKCRNKFLDTLRTLGEKFKQKQWGWAWAEGGQQLALEESLEV 347

Human   182 IPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEFTE-QTA 245
            ..||..:.:            ||.|||..  .:..:|..:|:.:.:|::.      |.:.. .||
  Fly   348 GGFGYPAMA------------VVNFKKMK--FSVLKGSFSKDGINEFLRD------ISYGRGHTA 392

Human   246 PKIFGGEIKTHILLFLPKSVSDYDGK 271
            |  ..|..|..|:     ||..:|||
  Fly   393 P--VRGAKKPAIV-----SVDPWDGK 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P4HBXP_024306545.1 YbbN 24..394 CDD:331940 85/286 (30%)
CaBP1NP_001285979.1 PDI_a_P5 26..119 CDD:239299
PDI_a_P5 157..262 CDD:239299 53/107 (50%)
Thioredoxin_6 190..383 CDD:290560 56/209 (27%)
P5_C 271..400 CDD:239281 24/150 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.