DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and PAPLN

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001352835.1 Gene:PAPLN / 89932 HGNCID:19262 Length:1278 Species:Homo sapiens


Alignment Length:271 Identity:58/271 - (21%)
Similarity:82/271 - (30%) Gaps:101/271 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 GINGDSKLDNNLDSSDSPMFEDSELMAHNTTVQ-------LGGTAFLVCKVSGVDRVGVNWNQIS 115
            |:.||:       .|.:|.|..|........|:       ||....|.|.......     :|.:
Human   890 GLGGDA-------GSPAPPFHSSSYRISLAGVEPSLVQAALGQLVRLSCSDDTAPE-----SQAA 942

  Fly   116 WIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVSTPTGIISHFVN 180
            |  ::|...:||....         |...||    |.|..:|..|.|.|.|. ||..|..|..:.
Human   943 W--QKDGQPISSDRHR---------LQFDGS----LIIHPLQAEDAGTYSCG-STRPGRDSQKIQ 991

  Fly   181 LQVVVPEAFILGSGELH--------------------------------------------VDM- 200
            |:::..:..:|...||.                                            ||. 
Human   992 LRIIGGDMAVLSEAELSRFPQPRDPAQDFGQAGAAGPLGAIPSSHPQPANRLRLDQNQPRVVDAS 1056

  Fly   201 -GSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGPRTQ----SRLIIREPQVT 260
             |..|.:.|..|..|.|.  :.||::.:.::              .||.|    ..|:|....|.
Human  1057 PGQRIRMTCRAEGFPPPA--IEWQRDGQPVS--------------SPRHQLQPDGSLVISRVAVE 1105

  Fly   261 DSGNYTCSASN 271
            |.|.|||.|.|
Human  1106 DGGFYTCVAFN 1116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 25/103 (24%)
Ig_3 193..271 CDD:404760 24/127 (19%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 1/3 (33%)
Ig strand F 264..269 CDD:409353 3/4 (75%)
PAPLNNP_001352835.1 TSP1 29..80 CDD:214559
ADAM_spacer1 183..298 CDD:310520
TSP1 308..361 CDD:214559
TSP1 369..424 CDD:214559
TSP1 424..481 CDD:214559
TSP1 488..539 CDD:214559
Kunitz_BPTI 753..805 CDD:278443
Papilin_u7 814..905 CDD:318767 6/21 (29%)
Ig 914..>978 CDD:325142 19/83 (23%)
I-set 1049..1119 CDD:254352 23/84 (27%)
IG 1139..1219 CDD:214652
PLAC 1235..1267 CDD:312271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.