Sequence 1: | NP_652462.3 | Gene: | dpr12 / 50320 | FlyBaseID: | FBgn0085414 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011541328.1 | Gene: | KIRREL3 / 84623 | HGNCID: | 23204 | Length: | 809 | Species: | Homo sapiens |
Alignment Length: | 225 | Identity: | 57/225 - (25%) |
---|---|---|---|
Similarity: | 83/225 - (36%) | Gaps: | 54/225 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 61 GDSKLDNNLDSSDSPMF--EDSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWH 123
Fly 124 ILSSGAQLYTNDERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVSTP-TGIISHFVNLQVVVPE 187
Fly 188 AFILGSGE----LHVDMGSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTP---- 244
Fly 245 --GPRTQSRLIIREPQVTDSGNYTCSASNT 272 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr12 | NP_652462.3 | IG | 86..183 | CDD:214652 | 26/97 (27%) |
Ig_3 | 193..271 | CDD:404760 | 21/87 (24%) | ||
Ig strand B | 204..208 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 219..223 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 250..254 | CDD:409353 | 1/3 (33%) | ||
Ig strand F | 264..269 | CDD:409353 | 2/4 (50%) | ||
KIRREL3 | XP_011541328.1 | Ig | 58..149 | CDD:299845 | |
IG_like | 60..149 | CDD:214653 | |||
I-set | 156..249 | CDD:254352 | |||
Ig2_KIRREL3-like | 171..252 | CDD:143236 | |||
Ig_2 | 260..337 | CDD:290606 | 2/9 (22%) | ||
I-set | 341..422 | CDD:254352 | 29/110 (26%) | ||
IGc2 | 355..406 | CDD:197706 | 20/75 (27%) | ||
Ig5_KIRREL3 | 424..521 | CDD:143306 | 24/98 (24%) | ||
IG_like | 432..521 | CDD:214653 | 21/88 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |