| Sequence 1: | NP_652462.3 | Gene: | dpr12 / 50320 | FlyBaseID: | FBgn0085414 | Length: | 326 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_009293693.1 | Gene: | igsf9bb / 569554 | ZFINID: | ZDB-GENE-091112-15 | Length: | 1439 | Species: | Danio rerio |
| Alignment Length: | 259 | Identity: | 59/259 - (22%) |
|---|---|---|---|
| Similarity: | 91/259 - (35%) | Gaps: | 59/259 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 56 RGGINGDSKLD-NNLDSSDSPMFEDSELMA-------HN-----TTVQL---------------- 91
Fly 92 GGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKFV 156
Fly 157 QRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPTPPQYVY 221
Fly 222 WQKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSASNT----EPASIYVFV 281 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr12 | NP_652462.3 | IG | 86..183 | CDD:214652 | 23/117 (20%) |
| Ig_3 | 193..271 | CDD:404760 | 18/77 (23%) | ||
| Ig strand B | 204..208 | CDD:409353 | 0/3 (0%) | ||
| Ig strand C | 219..223 | CDD:409353 | 1/3 (33%) | ||
| Ig strand E | 250..254 | CDD:409353 | 1/3 (33%) | ||
| Ig strand F | 264..269 | CDD:409353 | 3/4 (75%) | ||
| igsf9bb | XP_009293693.1 | IG_like | 30..113 | CDD:214653 | 7/25 (28%) |
| Ig | 41..113 | CDD:143165 | 7/25 (28%) | ||
| IG_like | 144..223 | CDD:214653 | 20/98 (20%) | ||
| IGc2 | 151..208 | CDD:197706 | 17/76 (22%) | ||
| I-set | 227..319 | CDD:254352 | 23/97 (24%) | ||
| Ig | <263..319 | CDD:299845 | 18/61 (30%) | ||
| Ig_2 | 326..414 | CDD:290606 | |||
| IG_like | 329..403 | CDD:214653 | |||
| IG_like | 424..504 | CDD:214653 | |||
| Ig | 440..504 | CDD:299845 | |||
| FN3 | 509..604 | CDD:238020 | |||
| FN3 | 620..704 | CDD:238020 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||