Sequence 1: | NP_652462.3 | Gene: | dpr12 / 50320 | FlyBaseID: | FBgn0085414 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009291422.1 | Gene: | ush2a / 568982 | ZFINID: | ZDB-GENE-060503-794 | Length: | 5243 | Species: | Danio rerio |
Alignment Length: | 234 | Identity: | 48/234 - (20%) |
---|---|---|---|
Similarity: | 85/234 - (36%) | Gaps: | 82/234 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 122 WHILSSGAQLYTNDERFAILHTPGSNMWT-LQIKFVQRRDHGMYECQVST----------PTGII 175
Fly 176 SHFVNLQVVVPE------AFILGSGELHV------------DMGSTINLVCIIEKSPTPPQYVYW 222
Fly 223 QKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSASNTEPASIYVFVSKGDNM 287
Fly 288 AAISRRKTSSADRLTHIFRSMLAPCLLLNTVVVRH-IFL 325 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr12 | NP_652462.3 | IG | 86..183 | CDD:214652 | 17/71 (24%) |
Ig_3 | 193..271 | CDD:404760 | 14/89 (16%) | ||
Ig strand B | 204..208 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 219..223 | CDD:409353 | 1/3 (33%) | ||
Ig strand E | 250..254 | CDD:409353 | 0/3 (0%) | ||
Ig strand F | 264..269 | CDD:409353 | 1/4 (25%) | ||
ush2a | XP_009291422.1 | Laminin_G_3 | 160..297 | CDD:290121 | |
Laminin_N | 307..528 | CDD:295486 | |||
EGF_Lam | 529..577 | CDD:238012 | |||
EGF_Lam | 586..638 | CDD:238012 | |||
Laminin_EGF | 653..703 | CDD:278482 | |||
Laminin_EGF | 706..756 | CDD:278482 | |||
EGF_Lam | 759..797 | CDD:214543 | |||
Laminin_EGF | 808..857 | CDD:278482 | |||
EGF_Lam | 859..912 | CDD:238012 | |||
EGF_Lam | 913..963 | CDD:238012 | |||
EGF_Lam | 965..1014 | CDD:238012 | |||
EGF_Lam | 1015..1064 | CDD:238012 | |||
FN3 | 1177..1253 | CDD:238020 | |||
FN3 | 1264..1375 | CDD:238020 | |||
FN3 | 1386..1469 | CDD:214495 | |||
LamG | 1537..1699 | CDD:238058 | |||
LamG | 1737..1890 | CDD:238058 | |||
FN3 | 1981..2071 | CDD:238020 | |||
FN3 | 2163..2253 | CDD:238020 | |||
FN3 | 2258..2341 | CDD:238020 | |||
FN3 | 2352..2443 | CDD:238020 | |||
FN3 | 2447..2544 | CDD:238020 | |||
FN3 | 2547..2633 | CDD:238020 | |||
FN3 | 2635..2733 | CDD:238020 | |||
FN3 | 2743..2807 | CDD:238020 | |||
FN3 | 2830..2932 | CDD:238020 | 12/51 (24%) | ||
fn3 | 2939..3014 | CDD:278470 | 14/92 (15%) | ||
FN3 | 3032..>3099 | CDD:238020 | 15/53 (28%) | ||
FN3 | 3542..3611 | CDD:238020 | |||
FN3 | 3615..3701 | CDD:238020 | |||
fn3 | 3718..3784 | CDD:278470 | |||
FN3 | 3801..3887 | CDD:238020 | |||
FN3 | 3908..3971 | CDD:238020 | |||
FN3 | 3996..4086 | CDD:238020 | |||
FN3 | 4186..4284 | CDD:238020 | |||
fn3 | 4288..4366 | CDD:278470 | |||
FN3 | 4382..4465 | CDD:238020 | |||
FN3 | 4470..4553 | CDD:238020 | |||
FN3 | 4555..4653 | CDD:238020 | |||
FN3 | 4679..4753 | CDD:238020 | |||
fn3 | 4760..4830 | CDD:278470 | |||
FN3 | 4864..4955 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |