Sequence 1: | NP_652462.3 | Gene: | dpr12 / 50320 | FlyBaseID: | FBgn0085414 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021334866.1 | Gene: | dscama / 568643 | ZFINID: | ZDB-GENE-050310-7 | Length: | 2025 | Species: | Danio rerio |
Alignment Length: | 198 | Identity: | 52/198 - (26%) |
---|---|---|---|
Similarity: | 80/198 - (40%) | Gaps: | 51/198 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 91 LGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKF 155
Fly 156 VQRRDHGMYEC-------------QVSTPTG---IISHFVNLQVVVPEAFILGSGELHVDMGSTI 204
Fly 205 NLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSA 269
Fly 270 SNT 272 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr12 | NP_652462.3 | IG | 86..183 | CDD:214652 | 26/107 (24%) |
Ig_3 | 193..271 | CDD:404760 | 21/77 (27%) | ||
Ig strand B | 204..208 | CDD:409353 | 1/3 (33%) | ||
Ig strand C | 219..223 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 250..254 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 264..269 | CDD:409353 | 2/4 (50%) | ||
dscama | XP_021334866.1 | Ig | 124..217 | CDD:325142 | |
I-set | 236..311 | CDD:254352 | |||
IG_like | 321..402 | CDD:214653 | 21/90 (23%) | ||
I-set | 408..502 | CDD:333254 | 29/101 (29%) | ||
IGc2 | 524..579 | CDD:197706 | |||
Ig | 614..679 | CDD:319273 | |||
Ig_DSCAM | 708..787 | CDD:143211 | |||
Ig | 805..898 | CDD:325142 | |||
FN3 | 894..988 | CDD:238020 | |||
FN3 | 995..1092 | CDD:238020 | |||
fn3 | 1100..1186 | CDD:306538 | |||
fn3 | 1199..1282 | CDD:306538 | |||
Ig | 1312..1377 | CDD:319273 | |||
fn3 | 1405..1471 | CDD:306538 | |||
FN3 | 1492..1563 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |