DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and dscama

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_021334866.1 Gene:dscama / 568643 ZFINID:ZDB-GENE-050310-7 Length:2025 Species:Danio rerio


Alignment Length:198 Identity:52/198 - (26%)
Similarity:80/198 - (40%) Gaps:51/198 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKF 155
            :|....|.|.|:|.|..     ::||.|..|  .:::||.:..|          |.|...|.:..
Zfish   328 VGSQVSLSCSVTGSDEF-----ELSWYRNGD--KINTGANIRMN----------GINKENLVMDG 375

  Fly   156 VQRRDHGMYEC-------------QVSTPTG---IISHFVNLQVVVPEAFILGSGELHVDMGSTI 204
            :.:.|.|:|:|             ||....|   |:|.| :.:||.|..|              :
Zfish   376 MAKSDGGVYQCFSRKAKMSAQDFVQVI
LEDGTPKILSAF-SEKVVGPNDF--------------V 425

  Fly   205 NLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSA 269
            :|.|.::.:|.|.  :.|..:|.:: ..|||..|....|......|.|.|...||.|||.|.|:.
Zfish   426 SLTCHVKGTPQPA--ITWTLDDEVV-AKDSRHRIVHSITAEGNVVSYLNISHIQVRDSGVYRCTC 487

  Fly   270 SNT 272
            :|:
Zfish   488 NNS 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 26/107 (24%)
Ig_3 193..271 CDD:404760 21/77 (27%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 2/3 (67%)
Ig strand F 264..269 CDD:409353 2/4 (50%)
dscamaXP_021334866.1 Ig 124..217 CDD:325142
I-set 236..311 CDD:254352
IG_like 321..402 CDD:214653 21/90 (23%)
I-set 408..502 CDD:333254 29/101 (29%)
IGc2 524..579 CDD:197706
Ig 614..679 CDD:319273
Ig_DSCAM 708..787 CDD:143211
Ig 805..898 CDD:325142
FN3 894..988 CDD:238020
FN3 995..1092 CDD:238020
fn3 1100..1186 CDD:306538
fn3 1199..1282 CDD:306538
Ig 1312..1377 CDD:319273
fn3 1405..1471 CDD:306538
FN3 1492..1563 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.