DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and aebp1b

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_696022.6 Gene:aebp1b / 567630 ZFINID:ZDB-GENE-030131-8546 Length:1247 Species:Danio rerio


Alignment Length:288 Identity:47/288 - (16%)
Similarity:89/288 - (30%) Gaps:109/288 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ILLLCLPTLLLATTLEPDQKSILTDNDWKKLWMRGGINGDSKL------------DNNLDSSDSP 75
            :::|||..|:.:                   |...|:...||.            |.|:.|.:..
Zfish    10 LVVLCLSLLVPS-------------------WEVNGLTEHSKSEISHTDREQHVEDRNVTSVEDL 55

  Fly    76 MFEDSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAI 140
            :  ..:::....|:::|....|:||||. |...:||            :..:|.::.|......:
Zfish    56 L--QVKIIPPYATIEVGQHKQLLCKVSS-DAKNINW------------VSPNGEKVLTKHGNLKV 105

  Fly   141 LHTPGSNMWTLQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVV-------------------- 185
             |..||.:.:|.:......:.|:|:|..:.........|.|.:::                    
Zfish   106 -HNHGSVLSSLTVLNANLNNAGIYKCVATNGDTESQATVKLDIILKRMRRDTDRKGREKRLKEPK 169

  Fly   186 -------------PEAFILGSGE--------LHVDMGSTINLVCIIEKSPTPPQY---------V 220
                         |::...|.||        .:.:..:|:....:...:..|.:|         .
Zfish   170 PSKKPKASKPTKKPKSEKKGKGEKGGKKKGKKNREESTTVATTTVAPTTTVPMEYEEFYDPEPDQ 234

  Fly   221 YWQKNDRLINYVDSRRDITIETTPGPRT 248
            ||.:            |...|||...||
Zfish   235 YWDE------------DFPAETTTVART 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 21/96 (22%)
Ig_3 193..271 CDD:404760 13/73 (18%)
Ig strand B 204..208 CDD:409353 0/3 (0%)
Ig strand C 219..223 CDD:409353 2/12 (17%)
Ig strand E 250..254 CDD:409353
Ig strand F 264..269 CDD:409353
aebp1bXP_696022.6 Ig 56..147 CDD:299845 21/106 (20%)
IG_like 62..145 CDD:214653 20/96 (21%)
FA58C 402..555 CDD:238014
FA58C 403..556 CDD:214572
Peptidase_M14_like 577..1036 CDD:299699
Peptidase_M14NE-CP-C_like 1040..1115 CDD:200604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.