DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and paplna

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_005169942.1 Gene:paplna / 562930 ZFINID:ZDB-GENE-070815-4 Length:1187 Species:Danio rerio


Alignment Length:297 Identity:69/297 - (23%)
Similarity:108/297 - (36%) Gaps:88/297 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPMVPPRLLLRLRRPLHLMELRILLLCLPTLL------LATTLEPDQKSILTDNDWKKLWMRGGI 59
            :|:.|.|         |..:|...||..|..|      |......|::      |.:.:::  .:
Zfish   873 VPVDPTR---------HEQQLDGSLLVGPITLQDSGWFLCVATRDDKR------DHRYIYL--SV 920

  Fly    60 NGDSKLDNN-----LDSSD--------------SPMFEDSELMAHNTTVQLGGTAFLVCK---VS 102
            :|.|:  ||     :|||.              ||:.|          .:.|.||.|.|.   ||
Zfish   921 SGSSQ--NNAGISEVDSSQSYTSQSSSRFNIDYSPLVE----------ARAGQTAKLQCSVLPVS 973

  Fly   103 GVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKFVQRRDHGMYECQ 167
            .:..|.::|::             :|..|  |..|.: .|:.|    ||.||.:...|.|:|.|.
Zfish   974 AIHAVTIHWSR-------------AGQPL--NSLRHS-QHSDG----TLVIKQLTADDSGLYTCT 1018

  Fly   168 VSTPTGIISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPTPPQYVYWQKNDRLINYV 232
            |:.........|.|:|:..........::.|..|||..|.|::.....   .|.|.:|...:...
Zfish  1019 VTDAQKFEERQVQLRVLGDLRITKAPIDVDVVQGSTAQLACVVTGENV---NVGWSRNGVPVRPD 1080

  Fly   233 DSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSA 269
            ..|..::.:.|        ||:...|..|.|.|||:|
Zfish  1081 GHRVHVSADGT--------LILNNVQSVDEGTYTCNA 1109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 26/99 (26%)
Ig_3 193..271 CDD:404760 20/77 (26%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 1/3 (33%)
Ig strand E 250..254 CDD:409353 1/3 (33%)
Ig strand F 264..269 CDD:409353 3/4 (75%)
paplnaXP_005169942.1 TSP1 24..75 CDD:214559
ADAM_spacer1 181..293 CDD:310520
TSP1 303..356 CDD:214559
TSP1 388..442 CDD:214559
TSP1 449..498 CDD:214559
TSP1 504..557 CDD:214559
KU 720..771 CDD:238057
Ig_3 839..906 CDD:316449 10/41 (24%)
IGc2 960..1022 CDD:197706 24/81 (30%)
I-set 1039..1121 CDD:333254 20/82 (24%)
PLAC 1142..1173 CDD:312271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.