DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and robo4

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_689255.3 Gene:robo4 / 560765 ZFINID:ZDB-GENE-020809-1 Length:1134 Species:Danio rerio


Alignment Length:255 Identity:51/255 - (20%)
Similarity:88/255 - (34%) Gaps:62/255 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 EDSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILH 142
            ||..:...:..|.:|..|.:.|.    ..||.....::|  |:|..:::|..:.|| :.:..::.
Zfish   173 EDFRVQPSDVEVAIGEMATINCS----PPVGHPEPNVTW--RKDGILINSSNEHYT-ELKGKLII 230

  Fly   143 TPGSNMWTLQIKFVQRRDHGMYECQVSTPTGI-ISHFVNLQVVVPEAFILGSGELHVDMGSTINL 206
            .|           .|:.|.|:|.|..|...|: .|....|.|:.....:....::.|.:|.:...
Zfish   231 AP-----------AQKNDSGVYSCIASNMIGVRESRAARLSVLAKPVLLRKPEDVSVQLGESAQF 284

  Fly   207 VCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQ------VT--DSG 263
            .|..:..|.|.  :.|.:..                  ||....|.:|....      ||  |.|
Zfish   285 FCEADGDPMPS--IEWSREQ------------------GPLPNGRYLINPDHSLQIHYVTAQDMG 329

  Fly   264 NYTCSASN---TEPASIYVFVSKGDNMAAISRRKTSSADRLTHIFRSMLAPCLLLNTVVV 320
            .|:|:..|   ...||..:.|            :.:...||..:.:.:.|..:.|..|.|
Zfish   330 RYSCTVENKLGVSVASAQLLV------------EDAGGTRLRDLHKELSALRVSLENVTV 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 22/97 (23%)
Ig_3 193..271 CDD:404760 16/85 (19%)
Ig strand B 204..208 CDD:409353 0/3 (0%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 1/3 (33%)
Ig strand F 264..269 CDD:409353 2/4 (50%)
robo4XP_689255.3 Ig1_Robo 70..169 CDD:143317
I-set 71..168 CDD:254352
I-set 175..261 CDD:254352 22/103 (21%)
Ig2_Robo 177..261 CDD:143201 22/101 (22%)
I-set 265..350 CDD:254352 19/104 (18%)
Ig 282..350 CDD:299845 17/87 (20%)
FN3 373..448 CDD:214495 2/5 (40%)
FN3 472..560 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.