DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and sdk1a

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_009297968.1 Gene:sdk1a / 558391 ZFINID:ZDB-GENE-081104-374 Length:2245 Species:Danio rerio


Alignment Length:208 Identity:58/208 - (27%)
Similarity:91/208 - (43%) Gaps:27/208 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GDSKLDNNLD-SSDSPMFEDSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHI 124
            |::::...|| :|.:|.|....|   :.||..|..|...|:|||..:..:.|       |||..|
Zfish   495 GEAQVHTYLDVTSMAPAFTAPPL---DITVTDGAVAAFTCRVSGAPKPAIVW-------RRDTQI 549

  Fly   125 LSSGAQLYTNDERFAILHTPGSNMWTLQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAF 189
            |:||:   ....||.:|.:.|     |||:.|..:|.|.|.|..:...|.|:...:|.|....:.
Zfish   550 LASGS---VQIPRFTLLESGG-----LQIQPVVLQDTGNYTCYAANSEGAINASASLTVWSRTSI 606

  Fly   190 ILGSGELHVDMGSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGPRTQSRLII 254
            .....:..|..|:|..|.|.....|.......|:|::.|:::....| |:::       :..|.|
Zfish   607 SSPPTDRRVIKGTTAILECGATHDPRVGVRYVWKKDEELVSHSRGGR-ISLQ-------EGSLHI 663

  Fly   255 REPQVTDSGNYTC 267
            .:....|.|||||
Zfish   664 SQTWSGDIGNYTC 676

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 31/96 (32%)
Ig_3 193..271 CDD:404760 19/75 (25%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 1/3 (33%)
Ig strand F 264..269 CDD:409353 4/4 (100%)
sdk1aXP_009297968.1 I-set 125..208 CDD:254352
Ig 125..204 CDD:299845
IG_like 222..302 CDD:214653
Ig 236..287 CDD:299845
Ig_3 322..394 CDD:290638
I-set 323..412 CDD:254352
I-set 416..505 CDD:254352 2/9 (22%)
Ig 436..500 CDD:299845 1/4 (25%)
I-set 510..600 CDD:254352 34/107 (32%)
Ig 527..600 CDD:299845 28/87 (32%)
I-set 605..693 CDD:254352 19/80 (24%)
Ig 610..693 CDD:299845 19/75 (25%)
FN3 697..788 CDD:238020
fn3 800..886 CDD:278470
FN3 901..997 CDD:238020
FN3 1002..1090 CDD:238020
FN3 1100..1196 CDD:238020
FN3 1206..1301 CDD:238020
FN3 1308..1397 CDD:238020
FN3 1408..1501 CDD:238020
FN3 1507..1602 CDD:238020
FN3 1616..1722 CDD:238020
FN3 1732..1825 CDD:238020
FN3 1830..1919 CDD:238020
FN3 1931..2021 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.