DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and KIRREL1

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_005245362.1 Gene:KIRREL1 / 55243 HGNCID:15734 Length:773 Species:Homo sapiens


Alignment Length:312 Identity:67/312 - (21%)
Similarity:104/312 - (33%) Gaps:84/312 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PPRLLLRLRRPLHLME-LRILLLCLPTLLLATTLEPDQKSILTDNDWKKLWMRGGI----NGDSK 64
            ||.:.|.: .|..:.| .|::..|      ..|..|:   ||...     |.:||.    ..:|:
Human   222 PPTVTLSI-EPQTVQEGERVVFTC------QATANPE---ILGYR-----WAKGGFLIEDAHESR 271

  Fly    65 LDNNLDSSDSPMF-EDSELMAHN-------------------------TTVQLGGTAFLVCKVSG 103
            .:.|:|.|   .| |......||                         ||..:|....|.|...|
Human   272 YETNVDYS---FFTEPVSCEVHNKVGSTNVSTLVNVHFAPRIVVDPKPTTTDIGSDVTLTCVWVG 333

  Fly   104 VDRVGVNWNQISWIRRRDWHI----------LSSGAQLYTNDERFAILHTPGSNMWTLQIKFVQR 158
            ...:.:.|.      ::|.::          .:..||:.:|..:             |.:|.|.:
Human   334 NPPLTLTWT------KKDSNMGPRPPGSPPEAALSAQVLSNSNQ-------------LLLKSVTQ 379

  Fly   159 RDHGMYECQVSTP-TGIISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPTPPQYVYW 222
            .|.|.|.|:...| .|:....|.|.|..| ..|......:...|....:.|.|..:| ||..:.|
Human   380 ADAGTYTCRAIVPRIGVAEREVPLYVNGP-PIISSEAVQYAVRGDGGKVECFIGSTP-PPDRIAW 442

  Fly   223 QKNDRLINYVDSRRDITIE-TTPGPRTQSRLIIREPQVTD-SGNYTCSASNT 272
            ...:..:. |.:....|:| |..|....|.|.|......| ..:|.|:|.|:
Human   443 AWKENFLE-VGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNS 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 23/132 (17%)
Ig_3 193..271 CDD:404760 19/79 (24%)
Ig strand B 204..208 CDD:409353 0/3 (0%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 2/3 (67%)
Ig strand F 264..269 CDD:409353 2/4 (50%)
KIRREL1XP_005245362.1 I-set 22..116 CDD:254352
Ig 25..116 CDD:299845
Ig2_KIRREL3-like 138..219 CDD:143236
I-set 223..304 CDD:254352 21/98 (21%)
Ig_2 227..305 CDD:290606 20/95 (21%)
Ig_2 311..405 CDD:290606 22/112 (20%)
IG_like 314..405 CDD:214653 22/109 (20%)
Ig5_KIRREL3 407..504 CDD:143306 22/90 (24%)
IG_like 416..504 CDD:214653 20/80 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.