DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and iglon5

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:269 Identity:56/269 - (20%)
Similarity:88/269 - (32%) Gaps:89/269 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 NTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWT 150
            |.||..|.:..|.||:.  :.|    ...:|:.|.  :||.:|...::.|.|.::.:...|: ::
Zfish    35 NITVLEGESVVLRCKID--EEV----THKAWLNRS--NILFTGTDKWSLDSRVSLENNNNSD-FS 90

  Fly   151 LQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPT 215
            ::|:.|...|.|.|.|.........:..|.|.|.||...:..|.:..|:.|..:||.|:....|.
Zfish    91 IRIERVMVADEGPYTCSFQARNKPRTAHVYLIVQVPARIVNISQDKSVNEGEDVNLFCLAVGRPE 155

  Fly   216 PPQYVYW----------------------------------------QKNDRLINYV-------- 232
            |.  :.|                                        :|....:||.        
Zfish   156 PT--ITWKDFKYGLLNEGEFLEITEIKRHQAEDFECITNNGVAPPDTRKVKVTVNYPPIITDVKN 218

  Fly   233 ---------------------------DSRRDITIETT---PGPRTQSRLIIREPQVTDSGNYTC 267
                                       |.||.:..:.|   ...:|:|.|:.........|||||
Zfish   219 MPAQVGKTAILRCEAMAVPTASFEWYRDDRRPVESDNTLKIKNEKTRSLLLFTNVTEKHFGNYTC 283

  Fly   268 SASNTEPAS 276
            .|||...||
Zfish   284 FASNRLGAS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 24/96 (25%)
Ig_3 193..271 CDD:404760 25/155 (16%)
Ig strand B 204..208 CDD:409353 2/3 (67%)
Ig strand C 219..223 CDD:409353 1/43 (2%)
Ig strand E 250..254 CDD:409353 2/3 (67%)
Ig strand F 264..269 CDD:409353 4/4 (100%)
iglon5NP_001017775.2 IG_like 33..123 CDD:214653 24/96 (25%)
Ig 35..123 CDD:299845 24/96 (25%)
Ig 125..>183 CDD:299845 11/59 (19%)
I-set 128..207 CDD:254352 10/80 (13%)
IG_like 217..298 CDD:214653 17/76 (22%)
ig 223..296 CDD:278476 17/70 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.