Sequence 1: | NP_652462.3 | Gene: | dpr12 / 50320 | FlyBaseID: | FBgn0085414 | Length: | 326 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001017775.2 | Gene: | iglon5 / 550472 | ZFINID: | ZDB-GENE-050417-297 | Length: | 332 | Species: | Danio rerio |
Alignment Length: | 269 | Identity: | 56/269 - (20%) |
---|---|---|---|
Similarity: | 88/269 - (32%) | Gaps: | 89/269 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 NTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWT 150
Fly 151 LQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPT 215
Fly 216 PPQYVYW----------------------------------------QKNDRLINYV-------- 232
Fly 233 ---------------------------DSRRDITIETT---PGPRTQSRLIIREPQVTDSGNYTC 267
Fly 268 SASNTEPAS 276 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr12 | NP_652462.3 | IG | 86..183 | CDD:214652 | 24/96 (25%) |
Ig_3 | 193..271 | CDD:404760 | 25/155 (16%) | ||
Ig strand B | 204..208 | CDD:409353 | 2/3 (67%) | ||
Ig strand C | 219..223 | CDD:409353 | 1/43 (2%) | ||
Ig strand E | 250..254 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 264..269 | CDD:409353 | 4/4 (100%) | ||
iglon5 | NP_001017775.2 | IG_like | 33..123 | CDD:214653 | 24/96 (25%) |
Ig | 35..123 | CDD:299845 | 24/96 (25%) | ||
Ig | 125..>183 | CDD:299845 | 11/59 (19%) | ||
I-set | 128..207 | CDD:254352 | 10/80 (13%) | ||
IG_like | 217..298 | CDD:214653 | 17/76 (22%) | ||
ig | 223..296 | CDD:278476 | 17/70 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |