| Sequence 1: | NP_652462.3 | Gene: | dpr12 / 50320 | FlyBaseID: | FBgn0085414 | Length: | 326 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011527877.1 | Gene: | NCAM2 / 4685 | HGNCID: | 7657 | Length: | 874 | Species: | Homo sapiens |
| Alignment Length: | 250 | Identity: | 63/250 - (25%) |
|---|---|---|---|
| Similarity: | 106/250 - (42%) | Gaps: | 36/250 - (14%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 37 LEPDQKSILTDNDWKKLWMRGGINGDS-----KLDNNLDSSDSPMFEDSELMAH-----NTTVQL 91
Fly 92 GGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTLQIKFV 156
Fly 157 QRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPTPPQYVY 221
Fly 222 WQKNDRLINYVDSRRDITIETTPGPRTQS--RLIIREPQVT---DSGNYTCSASN 271 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr12 | NP_652462.3 | IG | 86..183 | CDD:214652 | 27/96 (28%) |
| Ig_3 | 193..271 | CDD:404760 | 21/82 (26%) | ||
| Ig strand B | 204..208 | CDD:409353 | 2/3 (67%) | ||
| Ig strand C | 219..223 | CDD:409353 | 0/3 (0%) | ||
| Ig strand E | 250..254 | CDD:409353 | 2/5 (40%) | ||
| Ig strand F | 264..269 | CDD:409353 | 2/4 (50%) | ||
| NCAM2 | XP_011527877.1 | Ig1_NCAM-2 | 46..137 | CDD:143274 | |
| I-set | 47..136 | CDD:254352 | |||
| I-set | 142..218 | CDD:254352 | |||
| IGc2 | 153..214 | CDD:197706 | |||
| Ig | 233..326 | CDD:299845 | 11/50 (22%) | ||
| I-set | 240..323 | CDD:254352 | 11/47 (23%) | ||
| Ig5_NCAM-2 | 325..422 | CDD:143278 | 28/105 (27%) | ||
| IG_like | 333..420 | CDD:214653 | 26/95 (27%) | ||
| IG_like | 438..515 | CDD:214653 | 21/77 (27%) | ||
| IGc2 | 439..507 | CDD:197706 | 21/76 (28%) | ||
| FN3 | 521..613 | CDD:238020 | |||
| fn3 | 619..703 | CDD:278470 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||