DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and NCAM1

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001229536.1 Gene:NCAM1 / 4684 HGNCID:7656 Length:884 Species:Homo sapiens


Alignment Length:298 Identity:59/298 - (19%)
Similarity:112/298 - (37%) Gaps:72/298 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LEPDQKSILTDNDWKKLWMRG---GINGDSKLDNNLDSSDSPMFEDSELMAH------------N 86
            |:.|.:.|:..|::  |.:||   ...|..:.:..:.:.....|:|.:::.:            |
Human   160 LKKDVRFIVLSNNY--LQIRGIKKTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVN 222

  Fly    87 TTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPGSNMWTL 151
            .|..||.:..|||...|.....::|.:             .|.|:...::....:.:..|:.  |
Human   223 ATANLGQSVTLVCDAEGFPEPTMSWTK-------------DGEQIEQEEDDEKYIFSDDSSQ--L 272

  Fly   152 QIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPTP 216
            .||.|.:.|...|.|......|.....::|:|...........:..:::...:.|.|  |.|..|
Human   273 TIKKVDKNDEAEYICIAENKAGEQDATIHLKVFAKPKITYVENQTAMELEEQVTLTC--EASGDP 335

  Fly   217 PQYVYWQKNDRLINYVD-------SRRDI----------------------TIETTPG---PRTQ 249
            ...:.|:.:.|.|:..:       .::::                      :.||..|   .|:.
Human   336 IPSITWRTSTRNISSEEKASWTRPEKQEVHAPWNWQVGRQKGQAGSAGFPGSHETLDGHMVVRSH 400

  Fly   250 SR---LIIREPQVTDSGNYTCSASNT---EPASIYVFV 281
            :|   |.::..|.||:|.|.|:||||   :..|:|:.|
Human   401 ARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEV 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 21/96 (22%)
Ig_3 193..271 CDD:404760 21/112 (19%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 2/6 (33%)
Ig strand F 264..269 CDD:409353 2/4 (50%)
NCAM1NP_001229536.1 Ig1_NCAM-1 20..115 CDD:143273
IG 124..190 CDD:214652 8/31 (26%)
Ig 211..307 CDD:325142 22/110 (20%)
Ig 306..438 CDD:325142 26/133 (20%)
Ig_3 447..519 CDD:316449
FN3 534..631 CDD:238020
fn3 639..720 CDD:306538
Trypan_PARP <792..>864 CDD:330686
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.