DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and negr1

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:XP_009300786.1 Gene:negr1 / 445374 ZFINID:ZDB-GENE-040822-27 Length:360 Species:Danio rerio


Alignment Length:191 Identity:43/191 - (22%)
Similarity:76/191 - (39%) Gaps:45/191 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 GGTAFLVC-KVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILHTPG-SNMWTLQIK 154
            |.||.|.| .:.|:.:.       :|:.|..  |:.:|...::.|.|.:|:...| .:.::|||:
Zfish    52 GDTALLRCYLLDGISKG-------AWLNRSS--IIYAGNDKWSGDPRVSIVSNVGDKHEYSLQIQ 107

  Fly   155 FVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPTPPQY 219
            .|...|.|:|.|.:.:...:....:.|.|.||......|.::.|:.||.::|:|.....|.|.  
Zfish   108 KVDVTDEGVYTCSIQSERNLHPKLIQLIV
KVPPKIYDISSDITVNEGSNVSLICAASGKPEPK-- 170

  Fly   220 VYWQ---------KNDRLINYVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSASN 271
            :.|:         ::...:|.....||                       .:|:|.|.|.|
Zfish   171 ISWRHISPSARKYESGEYLNITGISRD-----------------------QAGDYECGAEN 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 23/92 (25%)
Ig_3 193..271 CDD:404760 16/86 (19%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 0/3 (0%)
Ig strand F 264..269 CDD:409353 2/4 (50%)
negr1XP_009300786.1 Ig 42..121 CDD:299845 22/77 (29%)
IG_like 44..136 CDD:214653 23/92 (25%)
I-set 140..222 CDD:254352 17/94 (18%)
IGc2 153..208 CDD:197706 14/79 (18%)
IG_like 236..312 CDD:214653
IGc2 238..304 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.