DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and Ama

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:222 Identity:51/222 - (22%)
Similarity:88/222 - (39%) Gaps:40/222 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 NLDS-SDSPMFEDSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNW---------NQISWIRRRDW 122
            :||| ..:|:...   ::.:....:|.:....|.|..|.::.|:|         |.:        
  Fly    25 SLDSVLSAPVISQ---ISKDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSV-------- 78

  Fly   123 HILSSGAQLYTNDERFAILHT----PGSNMWTLQIKFVQRRDHGMYECQV-STPTGIISHFVNLQ 182
             :||....|...|:|:.:..|    .||.::|.:|:.::..|.|.||||| .:.|..::..::||
  Fly    79 -VLSMRNILSLPDQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSLQ 142

  Fly   183 VVVPEAFILGSGE-LHVDMGSTINLVCIIEKSPTPPQYVYWQKNDRLINYVDSRRDITIETTPGP 246
            :..|......:.: ..|..|..:.|.|.....|.|.  :.|.:....:  :.:...:..|.|   
  Fly   143 IKTPPVIAENTPKSTLVTEGQNLELTCHANGFPKPT--ISWAREHNAV--MPAGGHLLAEPT--- 200

  Fly   247 RTQSRLIIREPQVTDSGNYTCSASNTE 273
                 |.||.....|.|.|.|.|.|.|
  Fly   201 -----LRIRSVHRMDRGGYYCIAQNGE 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 26/110 (24%)
Ig_3 193..271 CDD:404760 17/78 (22%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 0/3 (0%)
Ig strand E 250..254 CDD:409353 1/3 (33%)
Ig strand F 264..269 CDD:409353 2/4 (50%)
AmaNP_731114.2 I-set 33..143 CDD:254352 27/121 (22%)
Ig 37..127 CDD:299845 22/101 (22%)
IG_like 154..234 CDD:214653 19/81 (23%)
IGc2 161..223 CDD:197706 18/74 (24%)
I-set 254..330 CDD:254352
IGc2 254..322 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.