DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and dpr16

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001287169.1 Gene:dpr16 / 40619 FlyBaseID:FBgn0037295 Length:488 Species:Drosophila melanogaster


Alignment Length:277 Identity:81/277 - (29%)
Similarity:117/277 - (42%) Gaps:63/277 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 NTTVQLGGTAFLVCKV---SGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAIL------ 141
            |.|||.|..|:|.||:   ||        ..:||:|.||.||::.....:.||.|||.|      
  Fly   207 NATVQAGQHAYLPCKLNQHSG--------KPLSWVRLRDEHIIAVDHTTFINDARFASLLQSTTL 263

  Fly   142 ------------------------H-TPG--------SNMWTLQIKFVQRRDHGMYECQVSTPTG 173
                                    | .||        |..||||||:|...|.|.||||::|...
  Fly   264 TTLVSGGALSTTATPVAALGNSFAHAVPGGQERGNSSSLSWTLQIKYVNLEDAGWYECQLATEPK 328

  Fly   174 IISHFVNLQVVVPEAFILGSGELHVDMGSTINLVCIIEKSPTPPQYVYWQKNDRLIN-------- 230
             :|..|.|.|:.|...::|..:..|..||.:.|.||:..:...|:|::|.:.|:.:.        
  Fly   329 -MSAKVQLFVITPRTELIGDRQRFVKAGSRVELHCIVRGTLEAPKYIFWYRGDQQVTAENEASGA 392

  Fly   231 ----YVDSRRDITIETTPGPRTQSRLIIREPQVTDSGNYTCSASNTEPASIYVFVSKGDNMAAIS 291
                |....|:|...|.....|...|:|...:...||||||...|:..||:.:.|..|:..|:..
  Fly   393 QSGWYTQIDRNIFGSTEHNRNTIGSLVIPLVRKIHSGNYTCEPENSAAASMQLHVLSGEYSASAI 457

  Fly   292 RRKTSSADRLTHIFRSM 308
            :...:...||.|.:.|:
  Fly   458 KSTAARPHRLGHGYTSL 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 45/138 (33%)
Ig_3 193..271 CDD:404760 23/89 (26%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 1/3 (33%)
Ig strand E 250..254 CDD:409353 1/3 (33%)
Ig strand F 264..269 CDD:409353 4/4 (100%)
dpr16NP_001287169.1 IG_like 205..337 CDD:214653 45/138 (33%)
Ig <298..338 CDD:299845 18/40 (45%)
IG_like 352..447 CDD:214653 26/94 (28%)
Ig 358..439 CDD:143165 21/80 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I5030
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.