DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr12 and LSAMP

DIOPT Version :9

Sequence 1:NP_652462.3 Gene:dpr12 / 50320 FlyBaseID:FBgn0085414 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:355 Identity:75/355 - (21%)
Similarity:114/355 - (32%) Gaps:144/355 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RRPLHLMELRILLLCLPTLLLATTLEPDQKSILTDNDWKKLWMRGGINGDSKLDNNLDSSDSPMF 77
            |:.|.|:.||:|.| |||.|...:::               :.||                    
Human     9 RKQLPLVLLRLLCL-LPTGLPVRSVD---------------FNRG-------------------- 37

  Fly    78 EDSELMAHNTTVQLGGTAFLVCKVSGVDRVGVNWNQISWIRRRDWHILSSGAQLYTNDERFAILH 142
                  ..|.||:.|.||.|.|.|...:      ::::|:.|..  |:.:|...::.|.|.. |.
Human    38 ------TDNITVRQGDTAILRCVVEDKN------SKVAWLNRSG--IIFAGHDKWSLDPRVE-LE 87

  Fly   143 TPGSNMWTLQIKFVQRRDHGMYECQVSTPTGIISHFVNLQVVVPEAFILGSGELHVDMGSTINLV 207
            ...|..::|:|:.|...|.|.|.|.|.|.....:..|.|.|.||......|.::.|:.||.:.||
Human    88 KRHSLEYSLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLV 152

  Fly   208 CIIEKSPTP-----------------PQYV----------------------------------- 220
            |:....|.|                 .:|:                                   
Human   153 CMANGRPEPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNY 217

  Fly   221 --------------------------------YWQKNDRLINYVDSRRDITIETTPGPRTQSRLI 253
                                            .|.::|..||   |...:.|::|.|   ||.|.
Human   218 PPTITESKSNEATTGRQASLKCEASAVPAPDFEWYRDDTRIN---SANGLEIKSTEG---QSSLT 276

  Fly   254 IREPQVTDSGNYTCSASN---TEPASIYVF 280
            :........|||||.|:|   ...||:.:|
Human   277 VTNVTEEHYGNYTCVAANKLGVTNASLVLF 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr12NP_652462.3 IG 86..183 CDD:214652 28/96 (29%)
Ig_3 193..271 CDD:404760 27/161 (17%)
Ig strand B 204..208 CDD:409353 1/3 (33%)
Ig strand C 219..223 CDD:409353 1/70 (1%)
Ig strand E 250..254 CDD:409353 2/3 (67%)
Ig strand F 264..269 CDD:409353 4/4 (100%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 28/98 (29%)
Ig 132..215 CDD:386229 10/82 (12%)
Ig_3 219..294 CDD:372822 17/80 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.